KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_1384Help
Entry
GYO_1384          CDS       T01635                                 

Gene name
asnO
Definition
sporulation-specific asparagine synthase AsnO (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bst00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1271627..1273471
Genome map
AA seq 614 aa AA seqDB search
MCGITGWVDFKKQLVQEKQTINRMTDTLSKRGPDDSNVWGEHHVLFGHKRLAVVDIEGGR
QPMACTYKGDTYTIIYNGELYNTEDLRKELRARGHQFERTSDTEVLLHSYIEWQEDCVDH
LNGIFAFAVWDEKRDLLYAARDRLGVKPFFYTKQGSSFLFGSEIKAILAHPDIKAQVDRT
GLSEIFGLGPSRTPGTGVFKGIKEVRPAHALTFSKDGLNIWRYWNVESEKHTDSFDDTVA
NVRLLFQDAVTRQLVSDVPVCTFLSGGLDSSAITAIAAGHFEKGGKAPLHTYSIDYEEND
KFFQASAFQPNDDGPWIEKMTEAFGTTHHKCVISQKNLVDHLEEAVLVKDLPGMADVDSS
LLWFCREIKKDFVVSLSGECADEIFGGYPWFHMADVESGFPWMRSTEERIKLLSDSWQKK
LNLKEYVNAKYEETLAETPLLDGETGVDKARRQLFYLNMLWFMTNLLDRKDRMSMGASLE
VRVPFADHRLVEYVWNIPWEMKMHDNREKGILRKALEGILPDDILYRKKSPYPKTHHPEY
TKGVSEWLKTIRSQKDSVLHTLLDRKQLDQLLETEGSSFQVPWFGQLMKGPQLIAHLAQI
HTWFEAYRIDIDEG
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattacgggttgggtcgattttaaaaagcagctcgtccaggaaaaacaaacg
atcaacagaatgacagacactctttccaaacgggggcctgatgattctaacgtttgggga
gagcaccatgttttattcggacataaaaggcttgcggttgtggatattgaaggcggacgc
cagccgatggcatgcacttataaaggggatacgtacaccattatttacaatggtgagctg
tataacacggaggatctgcgcaaagaattgcgggcgcggggccatcagttcgagcggacg
tcagataccgaggtgctgctgcacagctatattgaatggcaggaagactgtgtagaccat
ctcaatggcatattcgcttttgctgtgtgggatgaaaagcgcgatctgctgtatgccgcg
agagaccgtctcggtgtgaagccgtttttttacacaaagcaaggatcttcttttctcttc
gggtccgaaataaaagcgatcctcgcacaccctgatataaaagcgcaagtggacagaaca
ggactttctgaaattttcgggcttggaccgtccagaactccgggaactggtgtatttaaa
ggcataaaagaagtccggccggctcacgcgctgacgttttctaaagacgggctgaatatt
tggcgttattggaatgttgaaagcgaaaaacatacggacagttttgatgacacggttgcc
aatgtcagattgttgtttcaggatgcggtgacgcgacagcttgtgtcggatgtgccggtt
tgtacgttcctatcaggcggactggactcaagcgccattacagcgattgcagcaggccat
tttgaaaagggaggaaaagcaccacttcatacttattcgattgattacgaagagaacgat
aaattttttcaagcgagcgcttttcagccgaatgacgacgggccttggattgaaaaaatg
acagaggccttcggcacaacacatcacaaatgtgtcatcagccaaaagaatctcgtcgat
catttggaggaagccgtgctggtcaaagacttgccgggaatggctgatgtcgactcgtct
ctgctgtggttttgccgggaaatcaaaaaggactttgtcgtcagcctgtcgggagagtgc
gcggatgagattttcggcgggtacccgtggttccatatggcagacgttgagtcgggcttc
ccatggatgaggtcgacagaagagcggatcaaactgctttctgattcatggcagaaaaaa
ttgaatctcaaagaatacgtaaatgccaaatacgaagaaaccttggcggaaacgccatta
ttagacggagaaacgggtgtggacaaagcaagaagacagctgttctatttaaatatgctt
tggtttatgacgaaccttttggatcggaaggatcgcatgagcatgggtgcgagccttgaa
gtgcgggtgccgttcgccgatcaccggctcgtggaatatgtttggaatatcccatgggaa
atgaaaatgcatgacaaccgggaaaaaggcattttgcgtaaagcgctcgagggcattttg
cctgatgacattctgtatcgcaaaaaaagcccgtatccgaaaacacaccatccggaatat
acaaaaggcgtcagcgaatggctgaaaacgatcagaagccaaaaggactcggtgcttcat
actctgctggacagaaaacaattggatcagcttttagagacagaaggctcttcctttcag
gttccgtggttcgggcagctcatgaaggggcctcagctgatcgcccaccttgcccaaatt
catacatggtttgaagcgtatcgcattgatattgatgagggataa

DBGET integrated database retrieval system