KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_1391Help
Entry
GYO_1391          CDS       T01635                                 

Definition
hypothetical protein
Orthology
K16043  
scyllo-inositol 2-dehydrogenase (NAD+) [EC:1.1.1.370]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Inositol phosphate metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    GYO_1391
Enzymes [BR:bst01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.370  scyllo-inositol 2-dehydrogenase (NAD+)
     GYO_1391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1279115..1280143
Genome map
AA seq 342 aa AA seqDB search
MKHQIRCAVLGLGRLGYYHAKNLVSSVPGAKLVSVGDPLKGRAEQVAREFGIEKWSEDPY
EMLEDPSIDAVIIVTPTSTHGDMIIKAAENGKQIFVEKPLTLSLEESKAVSEKVKETGVI
CQVGFMRRFDPAYADAKRRIDAGEIGKPIYYKGFTRDQGAPPAEFIKHSGGIFIDCSIHD
YDMARYLLGAEITSVSGHGRILNNPFMEQYGDVDQALTYLEFDSGAAGDVEASRTSPYGH
DIRAEVIGTEGSIFIGTLRNQHVTILTAKGSSYDIIPDFQTRFHEAYCLELQHFVECVRN
GTTPIVTDIDATINLEVGIAATNSYRSGRPVQLDVKGAHTSL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacatcaaataaggtgcgcagtattaggattaggaaggctcggttattatcatgcg
aaaaatctcgtctccagtgttccgggggcaaaactggtcagtgtcggtgatccgttgaaa
gggagagcggagcaggttgccagagaattcggtattgaaaaatggtcagaggacccgtat
gagatgttagaagatcccagcattgacgctgtcattatcgtaacgccgacaagcacacat
ggtgatatgatcatcaaagcagcggagaacggcaagcagatcttcgttgaaaaaccgctg
acattaagccttgaggaatcaaaggcagtttctgaaaaagtgaaagagacgggagtcatt
tgccaagtcggctttatgagacgattcgatcccgcatacgcagatgccaaacggcggatc
gacgctggggaaatcggcaaacccatctactataaaggctttacgcgcgaccagggagcg
cctcccgcagagtttatcaaacacagcggcgggatctttattgactgctctatccatgac
tatgatatggcccgttatttgctaggagcggagattacttctgtttcgggacacggcagg
atcctgaacaacccgtttatggagcagtatggcgatgtggatcaggcgctgacgtattta
gaatttgactccggtgctgcgggggatgtcgaggcaagcagaacctctccatacggacat
gacatccgggcggaagttatcgggactgagggcagtattttcatagggactttgagaaat
caacatgtgaccatcctgacagcgaaagggagcagctatgatattatcccagactttcaa
actcgttttcatgaagcctactgcttagagctgcagcattttgttgagtgtgtccggaat
ggaacaacaccgatcgtgacagatatcgatgcgacgatcaatttagaagtcggcatcgcc
gcgaccaattcgtatcgaagcggcaggcccgtacagctggatgtgaagggtgcgcacact
agtttgtaa

DBGET integrated database retrieval system