KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_1799Help
Entry
GYO_1799          CDS       T01635                                 

Definition
pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:bst01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bst00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bst00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bst00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1633914..1635242
Genome map
AA seq 442 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFVKPNDEVDEDDVLAEVQNDKAVVEIPSPVKGKVLELK
VEEGTVATVGQTIITFDAPGYEDLQFKGSEESDDAKTEAQVQSTAEAGQDVAKEEQAQEP
AKATGAGQQDQAEVDPNKRVIAMPSVRKYAREKGVDIRKVTGSGNNGRVVKEDIDSFVNG
GAQEAAPQETAAPQETAAKPAAAPAPEGEFPETREKMSGIRKAIAKAMVNSKHTAPHVTL
MDEVDVTNLVAHRKQFKQVAADQGIKLTYLPYVVKALTSALKKFPVLNTSIDDKTEEVVQ
KHYFNIGIAADTEKGLLVPVVKNADRKSVFEISDEINGLATKAREGKLAPAEMKGASCTI
TNIGSAGGQWFTPVINHPEVAILGIGRIAEKAIVRDGEIVAAPVLALSLSFDHRMIDGAT
AQNALNHIKRLLNDPQLILMEA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaacttccagatatcggggaaggtatccacgaaggcgaaatcgta
aaatggtttgtcaagcctaacgatgaggtagacgaggatgatgtactggctgaagtccaa
aatgataaagcagtagtagaaattccttcacctgttaaaggaaaagtattagaattaaaa
gttgaagagggaacggttgcaactgttggacaaacgatcattacgtttgatgcacctggt
tacgaagaccttcaatttaaaggcagcgaagagtcagatgatgcgaaaactgaagcacaa
gttcagtcaacagcagaagctggacaagacgttgcgaaagaagagcaagctcaagagcct
gcaaaagcaactggcgcaggacagcaggatcaagctgaagttgacccgaacaaacgcgtg
atcgctatgccttctgtacgtaaatatgctcgtgaaaaaggcgtagacatccgtaaagtt
actggttcagggaacaacggacgtgttgtaaaagaagatatcgacagctttgtaaacgga
ggagcgcaagaagctgcgccgcaagaaacagctgcaccacaagaaacagctgctaaaccg
gctgctgcaccagctccagagggcgaattcccagaaacacgcgaaaaaatgagcggtatc
cgtaaagcaattgcgaaagcgatggttaactctaaacacacagctcctcacgtaacgtta
atggacgaagtggacgtaacaaaccttgttgcacatcgtaaacagttcaaacaggttgct
gctgatcaaggaatcaagctgacttacttgccttacgttgtaaaagctcttacatctgca
ctgaaaaaattccctgttttaaacacgtcaattgacgataaaacagaagaagtagtccaa
aaacattacttcaacatcggtatcgctgctgacactgaaaaaggcttgcttgtaccggtt
gtgaaaaatgcagatcgtaaatctgtctttgaaatttctgatgagatcaatggccttgca
acaaaagctcgtgaaggcaagcttgctccagctgaaatgaaaggcgcatcttgcacaatt
acaaacatcggttctgccggcggacaatggttcactccggttatcaaccatccagaagtt
gcgattcttggtatcggacgcattgcagaaaaagcgattgttcgtgatggcgaaatcgta
gcagctccagtcttagctctttctctcagcttcgaccaccgtatgatcgacggagcaact
gcgcaaaatgcattaaatcacatcaagcgtttactgaacgatccacaattaattttaatg
gaggcgtaa

DBGET integrated database retrieval system