KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_1917Help
Entry
GYO_1917          CDS       T01635                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bst00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1745533..1746147
Genome map
AA seq 204 aa AA seqDB search
MKERGLLIVLSGPSGVGKGTVRQAIFSQEDTKFEYSISVTTRSPREGEVNGVDYFFKTRE
EFEQMIADNKLLEWAEYVGNYYGTPVDYVEQTLQDGKDVFLEIEVQGALQVRNAFPEGLF
IFLAPPSLSELKNRIVTRGTETDALIENRMKAAKAEIEMMDAYDYVVENDNVETACDKIK
AIVLAEHLKRERVAPRYKKMLEVE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaagagggttattaatcgttctctcaggtccctcaggagttggtaaaggaacg
gttcggcaagcgattttttcgcaggaagacacaaaatttgaatattcgatttcagtaacc
acaagaagtccgcgagagggcgaagtgaacggagtcgattatttcttcaaaacgagagaa
gaattcgagcaaatgattgcagacaacaagctgcttgaatgggcagagtatgtcggcaat
tattacggcacgcctgtcgattatgttgaacagacgcttcaagatggaaaagacgtcttt
ttagaaatcgaagttcaaggcgctcttcaagtgagaaatgctttcccggaaggcttgttt
attttccttgcgcctccaagcctttctgaactgaagaacagaattgtgacaagaggaacg
gaaacagacgctctgattgaaaatcgaatgaaagccgcaaaagctgagatcgaaatgatg
gatgcttatgattatgtcgttgaaaacgataatgtcgaaacggcttgcgataaaatcaaa
gcaatcgttctcgctgaacatttgaagcgcgagcgcgttgcgcctagatataagaaaatg
ctggaggttgaataa

DBGET integrated database retrieval system