KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_1917Help
Entry
GYO_1917          CDS       T01635                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst00230  Purine metabolism
bst01100  Metabolic pathways
Module
bst_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    GYO_1917 (gmk)
Enzymes [BR:bst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     GYO_1917 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 HEM4 AAA_16 RsgA_GTPase AAA_22 ABC_tran MMR_HSR1 AAA_29
Motif
Other DBs
NCBI-ProteinID: AEP86556
UniProt: G4NS95
Position
1745533..1746147
Genome map
AA seq 204 aa AA seqDB search
MKERGLLIVLSGPSGVGKGTVRQAIFSQEDTKFEYSISVTTRSPREGEVNGVDYFFKTRE
EFEQMIADNKLLEWAEYVGNYYGTPVDYVEQTLQDGKDVFLEIEVQGALQVRNAFPEGLF
IFLAPPSLSELKNRIVTRGTETDALIENRMKAAKAEIEMMDAYDYVVENDNVETACDKIK
AIVLAEHLKRERVAPRYKKMLEVE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaagagggttattaatcgttctctcaggtccctcaggagttggtaaaggaacg
gttcggcaagcgattttttcgcaggaagacacaaaatttgaatattcgatttcagtaacc
acaagaagtccgcgagagggcgaagtgaacggagtcgattatttcttcaaaacgagagaa
gaattcgagcaaatgattgcagacaacaagctgcttgaatgggcagagtatgtcggcaat
tattacggcacgcctgtcgattatgttgaacagacgcttcaagatggaaaagacgtcttt
ttagaaatcgaagttcaaggcgctcttcaagtgagaaatgctttcccggaaggcttgttt
attttccttgcgcctccaagcctttctgaactgaagaacagaattgtgacaagaggaacg
gaaacagacgctctgattgaaaatcgaatgaaagccgcaaaagctgagatcgaaatgatg
gatgcttatgattatgtcgttgaaaacgataatgtcgaaacggcttgcgataaaatcaaa
gcaatcgttctcgctgaacatttgaagcgcgagcgcgttgcgcctagatataagaaaatg
ctggaggttgaataa

DBGET integrated database retrieval system