KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_1961Help
Entry
GYO_1961          CDS       T01635                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bst01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bst00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bst00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:bst00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1784016..1785173
Genome map
AA seq 385 aa AA seqDB search
MNIHEYQGKEVLRKYGVSVPEGKVAFTAEEAVEKAKNLSSSVYVVKAQIHAGGRGKAGGV
KIAKSLDEVKAYADELLGKTLVTHQTGPDGQVIKRLLIEEGCDIKKEYYVGLVLDRATSR
IVLMASEEGGTEIEEVAEKTPEKIKKAVIDPAVGLQGYQAREIAFAINIPKELVGKAAKF
MLGLYKAFVEKDCSIAEINPLVVTGDGNVMALDAKLNFDSNALYRQKDIMEYRDLDEEDP
KEIEASKYDLSYISLDGNIGCMVNGAGLAMSTMDIIKHYGGEPANFLDVGGGATAEKVTE
AFKIILSDQNVKGIFVNIFGGIMKCDVIAEGVVEATRQVGLTLPLVVRLEGTNVDLGKKI
LSESGLNITSAESMADGAQKIVSLV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccagggaaaagaagtcctcagaaaatatggggtatctgttcct
gaaggtaaagtggcttttacagcagaagaagcagttgagaaagcaaagaacttatccagc
tcggtttatgtcgtaaaggctcaaattcatgctggcggtcgaggcaaagctggtggggta
aaaatagcaaaatcgttagacgaagtgaaagcgtatgccgacgaactcttagggaagacc
ctagttacacatcagacgggtccggacggccaagtaataaaacgcttacttattgaagaa
ggctgcgatattaaaaaagaatactacgtggggcttgtgcttgaccgcgccacttctaga
atcgttcttatggcttctgaagaaggcggaacggaaattgaagaagtagcggagaaaaca
ccggaaaaaatcaagaaagctgtcattgatccggctgtcggcctccaaggctatcaagct
agagaaatcgcattcgctattaatattccaaaagagcttgtgggaaaagctgctaaattt
atgcttggactatacaaagcatttgttgagaaagactgctcaatcgccgaaatcaatccg
ctcgttgttactggcgacggaaatgtgatggcgcttgatgcgaaattgaatttcgacagc
aacgcgttgtacagacaaaaggacattatggaatacagagatttggatgaagaagatccg
aaagaaatcgaagcgtccaaatatgacttaagctacatttctcttgatggaaatatcggc
tgtatggtaaacggcgcgggacttgcaatgtccacaatggatattatcaagcattatgga
ggagaacccgccaacttccttgatgtgggcggcggtgcaaccgcagaaaaagtcacggaa
gcatttaaaatcattctttctgatcaaaacgttaaagggatttttgtcaacattttcggc
ggcattatgaaatgtgatgtcatcgcagaaggggttgttgaagcgacaagacaagtcggt
ttgacattgccgcttgtcgtccgtcttgaaggcacaaacgtggatctagggaagaaaatc
cttagtgaatcaggattaaatattacatctgcggaatcaatggctgacggcgcgcagaaa
atcgtatccttagtttag

DBGET integrated database retrieval system