KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_1961Help
Entry
GYO_1961          CDS       T01635                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GYO_1961
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GYO_1961
   00640 Propanoate metabolism
    GYO_1961
   00660 C5-Branched dibasic acid metabolism
    GYO_1961
Enzymes [BR:bst01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GYO_1961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1784016..1785173
Genome map
AA seq 385 aa AA seqDB search
MNIHEYQGKEVLRKYGVSVPEGKVAFTAEEAVEKAKNLSSSVYVVKAQIHAGGRGKAGGV
KIAKSLDEVKAYADELLGKTLVTHQTGPDGQVIKRLLIEEGCDIKKEYYVGLVLDRATSR
IVLMASEEGGTEIEEVAEKTPEKIKKAVIDPAVGLQGYQAREIAFAINIPKELVGKAAKF
MLGLYKAFVEKDCSIAEINPLVVTGDGNVMALDAKLNFDSNALYRQKDIMEYRDLDEEDP
KEIEASKYDLSYISLDGNIGCMVNGAGLAMSTMDIIKHYGGEPANFLDVGGGATAEKVTE
AFKIILSDQNVKGIFVNIFGGIMKCDVIAEGVVEATRQVGLTLPLVVRLEGTNVDLGKKI
LSESGLNITSAESMADGAQKIVSLV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccagggaaaagaagtcctcagaaaatatggggtatctgttcct
gaaggtaaagtggcttttacagcagaagaagcagttgagaaagcaaagaacttatccagc
tcggtttatgtcgtaaaggctcaaattcatgctggcggtcgaggcaaagctggtggggta
aaaatagcaaaatcgttagacgaagtgaaagcgtatgccgacgaactcttagggaagacc
ctagttacacatcagacgggtccggacggccaagtaataaaacgcttacttattgaagaa
ggctgcgatattaaaaaagaatactacgtggggcttgtgcttgaccgcgccacttctaga
atcgttcttatggcttctgaagaaggcggaacggaaattgaagaagtagcggagaaaaca
ccggaaaaaatcaagaaagctgtcattgatccggctgtcggcctccaaggctatcaagct
agagaaatcgcattcgctattaatattccaaaagagcttgtgggaaaagctgctaaattt
atgcttggactatacaaagcatttgttgagaaagactgctcaatcgccgaaatcaatccg
ctcgttgttactggcgacggaaatgtgatggcgcttgatgcgaaattgaatttcgacagc
aacgcgttgtacagacaaaaggacattatggaatacagagatttggatgaagaagatccg
aaagaaatcgaagcgtccaaatatgacttaagctacatttctcttgatggaaatatcggc
tgtatggtaaacggcgcgggacttgcaatgtccacaatggatattatcaagcattatgga
ggagaacccgccaacttccttgatgtgggcggcggtgcaaccgcagaaaaagtcacggaa
gcatttaaaatcattctttctgatcaaaacgttaaagggatttttgtcaacattttcggc
ggcattatgaaatgtgatgtcatcgcagaaggggttgttgaagcgacaagacaagtcggt
ttgacattgccgcttgtcgtccgtcttgaaggcacaaacgtggatctagggaagaaaatc
cttagtgaatcaggattaaatattacatctgcggaatcaatggctgacggcgcgcagaaa
atcgtatccttagtttag

DBGET integrated database retrieval system