KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_2116Help
Entry
GYO_2116          CDS       T01635                                 

Definition
endo-1,4-beta-xylanase A (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Brite
Enzymes [BR:bst01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     GYO_2116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1995549..1996256
Genome map
AA seq 235 aa AA seqDB search
MKQKRMKFLLAVLFSLALTLPAWPAQAATTITSNQTGSQDGYDYELWKDYGNTSMTLNSG
GAFSAQWSNIGNALFRKGKKFDTTKTHSELGNISMNYNAAFNPGGNSYLCVYGWTKDPLV
EYYIVDNWGTYRPTGTPKGTFTVDGGTYDIYETTRINQPSIIGIATFKQYWSVRQTKRTS
GTVSVSEHFKKWESLGMPMGKMYETALTVEGYQSNGSANVTTNVLTVGGKSKSSF
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaaaagaatgaagtttttgttagcggttttatttagtctagcgctgacatta
cctgcatggcccgcacaggcggcaactactattacctcaaatcaaactggctctcaagat
ggctatgattatgaattgtggaaggattatgggaacaccagtatgacgctcaatagcggc
ggcgcatttagtgcccagtggagtaacattgggaatgctttattccgaaaaggcaagaaa
ttcgatacaaccaagactcactcagagcttggaaacatatcaatgaattacaacgcagcc
ttcaatccgggcggaaattcctatctatgtgtttatggatggacgaaagatccgctcgta
gaatattacatcgtagataattggggcacctatagaccgaccggaacgccaaagggtact
tttactgttgatgggggcacatatgatatttatgagaccactcgaatcaaccaaccttcc
attataggtatcgcaacctttaaacagtattggagtgtccggcagacaaaacgaacgagc
ggaaccgtatctgtcagcgaacacttcaagaagtgggaaagcttaggaatgccaatgggt
aagatgtatgaaaccgcgctaacggtagagggatatcaaagtaatggcagtgctaatgta
actactaatgtactgactgttggagggaaaagtaaatcatccttttaa

DBGET integrated database retrieval system