KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_2183Help
Entry
GYO_2183          CDS       T01635                                 

Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bst00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2043868..2045367
Genome map
AA seq 499 aa AA seqDB search
MKRSVSILIVCLFIALLANSGLTAPEASAAVTKTPVSINGQLSIKGTQLVNQNGKAVQLK
GISSHGLQWYGDFVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPSVKNKVKEAVEAAK
ELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGSTPNVIYEIANEPNGDVNWKRDI
KRYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQFLR
DKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLNYLNSKNISWVNWNLSDKQESS
SALKPGASKTGGWPLSGLSASGAFVRENILGTKDSTKDIPETPTQDQPTQKNSISVQYRA
GDGSVNGNQIRPQLHIKNNGNTRVDLKDITVRYWYNAKNKPQNFDCDYAQIGCGNVTHKF
VALHKPKQGADTYLELGFKNGTLSPGANTGDIQLRFHNDDWSNYAQGEDYSFFQSNMFKT
TEKITLYNHGKLIWGTEPK
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgttcagtctctatcttaattgtatgtttatttattgcattactagcaaatagc
ggcttgactgctccagaagcatctgcagcagtgacaaaaacgccagtatccataaatggc
cagcttagcataaaaggtacacagctagtcaatcaaaacggcaaagcggtgcagctgaag
gggatcagttcacacggattgcaatggtatggcgattttgtcaataaagacagcttaaaa
tggctgagagacgattggggcattacggttttccgcgcggcgatgtatacggccgacggc
ggttatattgataatccgtctgtgaaaaacaaagtaaaagaagcggttgaagcggcaaaa
gagcttgggatatatgtcatcattgactggcatatcttaaatgacggcaatccaaatcaa
aataaagagaaggcaaaagaattcttcaaggaaatgtcaagcctttacggaagcacgcca
aacgtcatttatgaaattgcgaacgaaccaaacggcgatgtgaactggaagcgtgatatt
aaacggtatgcggaagaagtgatttccgttatccgcaaaaacgatcccgacaacatcatt
attgtcggtaccggtacatggagccaggatgtgaatgatgctgccgatgatcagctaaag
gatgcaaatgtcatgtacgcgcttcatttttatgccggcacacatggccagtttttacgg
gataaagcaaactatgcactcagcaaaggagcacctatttttgtgacggagtgggggaca
agcgatgcttccggaaatggcggagtatttcttgaccagtcgagggaatggctgaattat
ctcaacagcaagaacatcagctgggtaaactggaatctttctgataagcaggaatcatct
tcagctttaaagccgggagcatctaaaacaggcggctggccgttatcaggtttatccgct
tcaggagcattcgtaagagaaaacattctcggtaccaaagattcgacgaaggacattcct
gaaacgccaacacaagatcaacccacacagaaaaacagcatttctgtgcaatacagggca
ggtgatggaagtgtgaacgggaaccaaatccgcccgcagcttcacataaaaaataacggc
aacaccagagttgatttaaaagatatcactgtccgttactggtataacgcaaaaaacaaa
cctcaaaactttgactgtgactacgcgcagattggatgcggcaatgtgacccacaagttt
gtggcgttacataaacctaagcagggtgcagatacctatctggaactagggtttaaaaat
ggaacgctgtcaccgggagcaaacacaggggatattcagcttcgttttcacaatgatgac
tggagcaattatgcacagggtgaggattattcctttttccaatcaaatatgtttaaaaca
acggaaaaaatcacattatataatcacggaaaactgatttggggaacagaacccaaatag

DBGET integrated database retrieval system