KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_2186Help
Entry
GYO_2186          CDS       T01635                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bst00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bst00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bst00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bst00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2046428..2047318
Genome map
AA seq 296 aa AA seqDB search
MKKIRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAVQSGIEDILIITGRN
KRAIEDHFDRSIELEQNLIEKGKTDILGEMQDIANLANIHYIRQKEPLGLGHAVLCAEHF
IGDEPFAVLLGDDIMVSETPALRQLMDVYDVYGTEVVGVQSVLPEDVSKYGIINTSGSQG
HVYEVNDLVEKPSPEEAPSEIAVMGRYVLNSSIFPVLKSIGRGAGNEIQLTDALREACRK
QPIHARLLEGNRYDIGDKLGCFKASTEIGLMRPEMRSQLLAYLEDVIKRETKEMLR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcagaaaagccgtcatccctgcagcaggtctaggaacacgttttttacct
gcaacgaaagctcagcctaaggaaatgctccctatcgttgataagcctgctattcaatat
atcgttgaggaagcggttcagtcaggtattgaagatattttgattattacagggcgaaac
aagcgcgcgattgaagatcattttgaccgttccattgagcttgaacagaatttgattgaa
aaagggaaaacagacatcttaggcgaaatgcaggacattgcaaatcttgcgaatatccat
tatattcgtcagaaggagccgcttggcttgggacatgccgttttgtgcgcggagcatttc
attggcgatgaaccgtttgccgtccttttaggtgatgatattatggtgtctgaaacaccg
gctcttcggcaattaatggatgtatatgacgtttatggcacagaggttgtcggtgtacag
tcagttctccctgaggatgtcagcaaatatggtattatcaatacatcagggtctcaaggg
catgtatacgaagtgaacgatttagtggaaaagccttctcctgaagaagcgccttcggaa
atcgccgtgatgggacgttatgtgctgaattcatcgatcttccccgttttaaagtccatt
ggcagaggcgcgggcaacgaaattcagcttacagatgcgcttcgtgaggcttgccgtaag
cagcctatccatgcccggctgctggaaggaaatcgatatgacattggcgataagctgggt
tgttttaaagcgagcactgaaatcggcttaatgcgccccgaaatgagatctcagcttttg
gcctatttagaagatgtgatcaaacgggaaacgaaagaaatgctgcgataa

DBGET integrated database retrieval system