KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_2186Help
Entry
GYO_2186          CDS       T01635                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GYO_2186 (galU)
   00052 Galactose metabolism
    GYO_2186 (galU)
   00500 Starch and sucrose metabolism
    GYO_2186 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    GYO_2186 (galU)
Enzymes [BR:bst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GYO_2186 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2046428..2047318
Genome map
AA seq 296 aa AA seqDB search
MKKIRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAVQSGIEDILIITGRN
KRAIEDHFDRSIELEQNLIEKGKTDILGEMQDIANLANIHYIRQKEPLGLGHAVLCAEHF
IGDEPFAVLLGDDIMVSETPALRQLMDVYDVYGTEVVGVQSVLPEDVSKYGIINTSGSQG
HVYEVNDLVEKPSPEEAPSEIAVMGRYVLNSSIFPVLKSIGRGAGNEIQLTDALREACRK
QPIHARLLEGNRYDIGDKLGCFKASTEIGLMRPEMRSQLLAYLEDVIKRETKEMLR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcagaaaagccgtcatccctgcagcaggtctaggaacacgttttttacct
gcaacgaaagctcagcctaaggaaatgctccctatcgttgataagcctgctattcaatat
atcgttgaggaagcggttcagtcaggtattgaagatattttgattattacagggcgaaac
aagcgcgcgattgaagatcattttgaccgttccattgagcttgaacagaatttgattgaa
aaagggaaaacagacatcttaggcgaaatgcaggacattgcaaatcttgcgaatatccat
tatattcgtcagaaggagccgcttggcttgggacatgccgttttgtgcgcggagcatttc
attggcgatgaaccgtttgccgtccttttaggtgatgatattatggtgtctgaaacaccg
gctcttcggcaattaatggatgtatatgacgtttatggcacagaggttgtcggtgtacag
tcagttctccctgaggatgtcagcaaatatggtattatcaatacatcagggtctcaaggg
catgtatacgaagtgaacgatttagtggaaaagccttctcctgaagaagcgccttcggaa
atcgccgtgatgggacgttatgtgctgaattcatcgatcttccccgttttaaagtccatt
ggcagaggcgcgggcaacgaaattcagcttacagatgcgcttcgtgaggcttgccgtaag
cagcctatccatgcccggctgctggaaggaaatcgatatgacattggcgataagctgggt
tgttttaaagcgagcactgaaatcggcttaatgcgccccgaaatgagatctcagcttttg
gcctatttagaagatgtgatcaaacgggaaacgaaagaaatgctgcgataa

DBGET integrated database retrieval system