KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_2413Help
Entry
GYO_2413          CDS       T01635                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst00480  Glutathione metabolism
bst00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    GYO_2413
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GYO_2413
Enzymes [BR:bst01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     GYO_2413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AEP87034
UniProt: G4NSH2
Position
complement(2271089..2271571)
Genome map
AA seq 160 aa AA seqDB search
MSIYDMKVRTITGKDMTLQPFAGKVLMIVNTASKCGFTPQLKQLQELYDTYQQEGLEILG
FPCNQFMNQEPGDEADIQDFCETNYGVTFPMFSKVEVNGKNAHPLFVYLTEHAKGMLGTK
AIKWNFTKFIVDRNGEIVGRYSPNTNPKELEDVIMKLLGQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtctatatatgatatgaaggtacgcacaataacagggaaagacatgacacttcagcct
tttgccggaaaggtattgatgatcgtgaatacagcgagtaaatgcggctttactccccaa
ttgaagcagcttcaggagttatatgatacatatcagcaggagggcctggagatcttaggg
ttcccctgcaatcaatttatgaaccaagagcctggtgacgaggcagacatacaggatttt
tgcgaaacaaattacggtgttacgtttcctatgttttcaaaagtagaagtaaatggaaaa
aacgcccacccgctgtttgtgtatttgacggagcacgcgaaagggatgctgggaactaag
gcgatcaagtggaatttcacgaagtttatagtggacagaaacggagaaatcgttggccga
tattcaccaaatacaaatccgaaagagctggaagacgttatcatgaagctattagggcaa
taa

DBGET integrated database retrieval system