KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_2490Help
Entry
GYO_2490          CDS       T01635                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst00260  Glycine, serine and threonine metabolism
bst00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bst01100  Metabolic pathways
bst01110  Biosynthesis of secondary metabolites
bst01130  Biosynthesis of antibiotics
bst01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GYO_2490 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GYO_2490 (trpA)
Enzymes [BR:bst01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GYO_2490 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA DUF1611_N
Motif
Other DBs
NCBI-ProteinID: AEP87110
UniProt: G4NSX9
Position
complement(2338060..2338863)
Genome map
AA seq 267 aa AA seqDB search
MFKLDLQASEKLFIPFITAGDPSPEVSVKLAKSLQKAGATALELGVAYSDPLADGPVIQR
ASKRALDHGMNIVKAIELGGEMKKNGVNIPIILFTYYNPVLQLNKEYFFALLRENHIDGL
LVPDLPLEESASLQAECKSHEVTYISLVAPTSESRLKTIIEQAEGFVYCVSSLGVTGVRN
EFNSSVYPFIRTVKDLSTVPVAVGFGISNREQVMKMNEICDGVVVGSALVRKIEELKDRL
ISAETRDQALQEFEDYATAFGGLYSLK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaattagatcttcaagcatcagaaaaattgtttatcccgtttattacagcggga
gatccatcgcctgaggtttcggttaaactggcgaagtcactccaaaaagcaggcgccaca
gcactggagcttggtgttgcatactcagacccgcttgcagacggtccggtgatccagcgt
gcttcaaagcgggcgcttgatcatggaatgaatatcgtaaaggcaatcgaattaggcgga
gaaatgaaaaaaaacggagtgaatattccgattatcctctttacgtattataatcctgtg
ttacaattgaacaaagaatactttttcgctttactgcgggaaaatcatattgacggtctg
cttgttccggatctgccattagaagaaagcgccagccttcaagcggaatgcaaaagccat
gaggtgacgtatatttctttggttgcgccgacaagcgaaagccgtttgaaaaccattatt
gaacaagccgagggcttcgtctactgtgtatcttctctaggtgtgaccggtgtccgcaat
gagttcaattcatccgtgtatccgttcatccggacagtgaaggatcttagcactgtgccg
gttgctgtaggattcggtatatcaaaccgcgaacaggtcatgaagatgaatgaaatttgt
gacggtgtcgtagtgggaagtgcgctcgtcagaaaaatagaagagctaaaggaccggctc
atcagcgctgaaacgagagatcaagcgctgcaggagtttgaagattacgcaacggcgttt
ggcggcttgtacagcttaaaatga

DBGET integrated database retrieval system