KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_2491Help
Entry
GYO_2491          CDS       T01635                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst00260  Glycine, serine and threonine metabolism
bst00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bst01100  Metabolic pathways
bst01110  Biosynthesis of secondary metabolites
bst01130  Biosynthesis of antibiotics
bst01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GYO_2491 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GYO_2491 (trpB)
Enzymes [BR:bst01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GYO_2491 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF4147
Motif
Other DBs
NCBI-ProteinID: AEP87111
UniProt: G4NSY0
Position
complement(2338856..2340058)
Genome map
AA seq 400 aa AA seqDB search
MYPYPNEIGRYGDFGGKFVPETLMQPLEEIETAFKEIKDDPVFRNEYYKLLNDYSGRPTA
LTFADRVTEYLGGAKIYLKREDLNHTGSHKINNALGQALLAKKMGKTKIIAETGAGQHGV
AAATVAAKFGFSCTVFMGEEDVARQSLNVFRMKLLGAEVVPVTSGNGTLKDATNEAIRYW
VQHCEDHFYMIGSVVGPHPYPQVVREFQKMIGEEAKDQLKHIEGTLPDKVVACVGGGSNA
MGMFQAFLDEDVELIGAEAAGKGIDTPLHAATMSKGTVGVIHGSLTYLIQDEFGQIIEPY
SISAGLDYPGIGPEHAYLHKSGRVTYDSITDEEAVDALKLLSEKEGILPAIESAHALAKA
FKLAKEMDRDQTVLVCLSGRGDKDVNTLMNVLEEEVKAHV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtatccatatccgaatgaaataggcagatacggtgatttcggcggaaagtttgttccg
gaaacactgatgcagccgttagaagaaattgaaaccgcatttaaagagatcaaggatgat
cctgtttttcgtaatgaatattacaagctgttaaatgactattccggaaggccgactgca
ctcacattcgctgatcgagtcactgagtatttaggcggtgcgaaaatttatttgaaacga
gaagatttgaaccatacagggtctcataaaatcaataatgcgttaggtcaagcgctgctc
gctaagaaaatgggaaaaacgaaaatcattgctgaaaccggtgccggtcagcacggtgtg
gccgctgcaacagtcgcagccaaattcggcttttcctgtactgtgtttatgggcgaggag
gatgttgcccgccagtctctgaacgttttccgcatgaagcttcttggtgcggaagttgtg
cctgtaacaagcggaaacggcacattgaaggatgccacaaatgaggcgattcggtactgg
gttcagcattgcgaggatcatttttacatgattggatcagttgtcggaccgcacccttat
ccgcaggtggtccgagaatttcagaaaatgattggagaggaagcgaaggatcagctgaaa
cacattgaaggcactctgcctgataaagtagtggcgtgtgtaggcggaggaagcaatgcg
atgggcatgtttcaggcgtttttagatgaagatgttgaactgatcggcgctgaagcagcc
ggaaaaggaattgatactcctcttcatgccgctactatgtcgaaaggaaccgtaggcgtt
attcatggttcattgacttatctgattcaagatgagttcgggcaaattattgagccttac
tccatttcagcaggactcgactatcctggaatcggtccggagcacgcttatttgcataag
agcggccgtgtcacttatgacagtatcacagatgaagaagcggtggatgcattaaaactc
ttgtcagaaaaagaggggattttgccggcgatcgaatctgcccatgcgttagcgaaagca
ttcaaactcgccaaagagatggatcgcgatcaaaccgttctcgtctgtttatcaggacgg
ggagataaggatgtcaacacattaatgaatgtattggaagaagaggtgaaagcgcatgtt
taa

DBGET integrated database retrieval system