KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_2506Help
Entry
GYO_2506          CDS       T01635                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst00790  Folate biosynthesis
bst01100  Metabolic pathways
Module
bst_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GYO_2506 (folE)
Enzymes [BR:bst01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     GYO_2506 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AEP87126
UniProt: G4NSZ5
Position
complement(2351340..2351912)
Genome map
AA seq 190 aa AA seqDB search
MKEVNKEQIEQAVRQILEAIGEDPNREGLLDTPKRVAKMYAEVFSGLNEDPKEHFQTIFG
ENHEELVLVKDIAFHSMCEHHLVPFYGKAHVAYIPRGGKVTGLSKLARAVEAVAKRPQLQ
ERITSTIAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVTSAVRGVFKDDAAARA
EVLEHIKRQD
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagttaataaagagcaaatcgaacaagctgttcgtcaaattttagaagcgatc
ggagaagacccgaatagagaagggcttcttgataccccgaaaagagtcgcaaagatgtat
gccgaagtattctccggcttgaatgaagatccaaaagaacatttccagactatcttcggt
gaaaaccatgaggagcttgttcttgtaaaagatatcgcgtttcattctatgtgtgagcat
caccttgttcccttttatggaaaagcacacgttgcatatataccgcgaggcggaaaggtc
acagggctcagcaaactggcacgtgccgttgaagccgttgcaaagcgtccgcagcttcag
gaacgcatcacttctacaattgcggaaagcatcgtagaaacgcttgacccgcatggcgta
atggtagtggttgaagcagaacacatgtgcatgacgatgcgcggtgtcagaaaaccgggt
gcaaaaactgtcacttcagcagtcagaggcgttttcaaagatgatgccgctgcccgcgct
gaagtattggaacatattaaacgccaggactaa

DBGET integrated database retrieval system