KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_2749Help
Entry
GYO_2749          CDS       T01635                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst00010  Glycolysis / Gluconeogenesis
bst00052  Galactose metabolism
bst00500  Starch and sucrose metabolism
bst00520  Amino sugar and nucleotide sugar metabolism
bst00521  Streptomycin biosynthesis
bst01100  Metabolic pathways
bst01110  Biosynthesis of secondary metabolites
bst01120  Microbial metabolism in diverse environments
bst01130  Biosynthesis of antibiotics
bst01200  Carbon metabolism
Module
bst_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bst_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYO_2749
   00052 Galactose metabolism
    GYO_2749
   00500 Starch and sucrose metabolism
    GYO_2749
   00520 Amino sugar and nucleotide sugar metabolism
    GYO_2749
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GYO_2749
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    GYO_2749
Enzymes [BR:bst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GYO_2749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FtsA
Motif
Other DBs
NCBI-ProteinID: AEP87360
UniProt: G4NQB1
Position
complement(2551536..2552501)
Genome map
AA seq 321 aa AA seqDB search
MDEIWFAGIDLGGTTIKLAFINQYGEIQHKWEVPTDKSGDTITVTIAKTIDSKLDELQKP
KHIIKYIGMGAPGPVDMAAGVVYETVNLGWKNYALKNHLETETGIPAVIENDANIAALGE
MWKGAGDGAKDVILVTLGTGVGGGIIANGEIVHGINGAGGEIGHICSIPEGGAPCNCGKT
GCIETIASATGIVRIAKEKIAKAKQTTRLKATEQLSARDVFEAAGENDEIALEVVDYVAK
HLGVVLGNLASSLNPSKIVLGGGVSRAGELLRSKVEKTFRKCAFPRAAEAADISIAALGN
DAGVIGGAWIAKNEWLKHQNC
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggacgaaatatggtttgcgggcattgatctgggaggaacgacaattaaactcgctttt
attaatcaatatggtgaaattcagcataagtgggaagtcccgactgataaaagcggcgac
accattaccgttacaattgcaaaaacaatcgacagtaagctggatgaactgcaaaaaccg
aagcatatcatcaaatacatcggaatgggcgcaccaggccctgtagatatggcggcagga
gtcgtttatgaaacggtaaatctggggtggaaaaactatgctttaaaaaaccatctcgag
acagaaaccggaatcccggctgttatagaaaatgacgcaaatattgctgcgctcggggaa
atgtggaagggagcgggtgatggcgcgaaagacgtcattctcgtgacgcttggcacagga
gttggcggcggcatcattgcaaatggtgaaattgtacatggcataaatggcgccggcggg
gaaatcggccatatttgtagcattcctgaaggcggggcgccttgcaactgcggcaaaacg
ggctgtatcgaaacgattgcgtcggcaaccggaattgtaagaattgcaaaagagaaaatt
gcaaaagctaagcagacgacacgtttaaaagcaactgaacaattgtcagcgcgggatgta
tttgaagcggcgggtgaaaatgacgaaattgcccttgaagtggttgattatgtggccaag
catcttggtgtggtgctgggaaatttggcaagctcgcttaatccatcaaaaatcgttctt
ggcggcggtgtatcaagagccggagaactgctgagatccaaagtcgagaaaacattccgc
aaatgtgcgtttccgcgggcagccgaagcggctgatatttcaatcgcagcacttggaaat
gatgccggcgttatcggaggcgcttggatcgctaaaaatgaatggctgaaacaccaaaat
tgttaa

DBGET integrated database retrieval system