KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_2852Help
Entry
GYO_2852          CDS       T01635                                 

Definition
(GenBank) putative threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst00260  Glycine, serine and threonine metabolism
bst00750  Vitamin B6 metabolism
bst01100  Metabolic pathways
bst01110  Biosynthesis of secondary metabolites
bst01120  Microbial metabolism in diverse environments
bst01230  Biosynthesis of amino acids
Module
bst_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GYO_2852
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GYO_2852
Enzymes [BR:bst01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GYO_2852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEP87460
UniProt: G4NXE1
Position
complement(2639688..2640791)
Genome map
AA seq 367 aa AA seqDB search
MEQYQCHSCRTKYNVSEQVWKCQCGGVLDLVKEKVEWSDSKVLKDIPSMWRYIDAMPFDR
DSTIWSGITMGEGYTPLIVLDSGEPNTLVKVDYMMPTLSFKDRGAAVLIAKAKELGVKHV
IADSSGNAGTSIAAYAKRANIACDIFLGKGTSPKKIAQVKAHGANVREIEGTREDVAEAA
QKAVNIEKKFYASHVFNPYFYEGTKTYAFEIWEQMNGEPDTLIIPVGNGTLLLGVYYGFK
ELLENKCIDKMPRLVAIQAENCAPLAKAFINNQQVAQPVENRGTLAEGISIAKPARSAQI
LEAIRATKGQIITTNEEEILKARTALASKGFYVEPTTAANYAGYLKYDHSSDEKIVIPLC
GAGIKSN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaacagtatcaatgtcattcttgccgtacgaaatacaatgtgtctgaacaggtgtgg
aaatgccagtgtggcggagtgttagaccttgtaaaagaaaaagtagaatggtccgattca
aaagtgctcaaagatattccttctatgtggagatatattgatgctatgccatttgatcgc
gactccaccatatggagcggcatcactatgggggagggatacacacctttaatcgtgtta
gacagcggggagccgaacactcttgtgaaagtggactatatgatgcctactttgtctttt
aaagatcgcggtgctgctgtattaatagctaaggcaaaggagctgggagtgaagcatgtg
atagctgacagcagtggaaatgcagggacatctattgcagcttacgccaagcgggctaac
atcgcatgtgacatatttcttgggaagggtacatcacctaagaaaatcgcgcaggtgaaa
gcgcatggggccaacgttcgcgaaattgaaggcacaagagaagatgtggccgaagcagcg
caaaaggctgtgaatatagagaaaaaattctatgcaagtcacgtttttaatccatatttc
tatgaaggaacaaaaacgtatgcctttgagatttgggaacaaatgaatggagagccggat
acgcttattattccagttggcaatggtacgttattacttggggtttactatggatttaaa
gaattactagagaacaaatgtatagacaaaatgccaagactggttgcgatacaggcagag
aattgtgcgccgttagcaaaggcatttatcaacaatcaacaagttgctcaacccgtcgaa
aacaggggaacacttgcagagggcatctcgattgccaaaccggcaagatcagctcaaata
ttagaagccatccgtgccacaaaaggtcaaatcattacaaccaatgaggaagagattcta
aaagctcgtacagcattagcaagtaaaggcttttatgttgagccaacaacagcagctaac
tatgcaggatatttaaaatacgatcattcttctgatgaaaaaatcgtgattccattatgc
ggggctgggattaaatctaattag

DBGET integrated database retrieval system