KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_3000Help
Entry
GYO_3000          CDS       T01635                                 

Definition
RelA/SpoT family protein (EC:2.7.6.5)
Orthology
K00951  
GTP pyrophosphokinase [EC:2.7.6.5]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Purine metabolism
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bst00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2766276..2768480)
Genome map
AA seq 734 aa AA seqDB search
MANEQVLTAEQVIDKARSYLSDEHIAFVEKAYLYAEDAHREQYRKSGEPYIIHPIQVAGI
LVDLEMDPSTIAGGFLHDVVEDTDVTLDDLKEAFSEEVAMLVDGVTKLGKIKYKSQEEQQ
AENHRKMFVAMAQDIRVILIKLADRLHNMRTLKHLPQEKQRRISNETLEIFAPLAHRLGI
SKIKWELEDTALRYLNPQQYYRIVNLMKKKRAERELYVDEVVNEVKKRVEEVNIKADFSG
RPKHIYSIYRKMVLQNKQFNEIYDLLAVRILVNSIKDCYAVLGIIHTCWKPMPGRFKDYI
AMPKPNMYQSLHTTVIGPKGDPLEVQIRTFEMHEIAEYGVAAHWAYKEGKAANEGATFEK
KLSWFREILEFQNESTDAEEFMESLKIDLFSDMVYVFTPKGDVIELPSGSVPIDFSYRIH
SEIGNKTIGAKVNGKMVTLDHKLRTGDIVEILTSKHSYGPSQDWVKLAQTSQAKHKIRQF
FKKQRREENVEKGRELVEKEIKNLDFEVKEVLTPENIQKVADKFNFSNEEDMYAAVGYNG
ITALQVANRLTEKERKQRDQEEQEKIVQEVNAEPKPYPQGRKREAGVRVKGIDNLLVRLS
KCCNPVPGDDIVGFITKGRGVSVHREDCPNVKTNEAQERLIPVEWEHESQVQKRKEYNVE
IEILGYDRRGLLNEVLQAVNETKTNISSVSGKSDRNKVATIHMAIFIQNINHLHKVVERI
KQIRDIYSVRRVMN
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgaacaagtattgactgccgagcaagttatagataaagcgcgcagctatcta
tctgatgagcatatcgcatttgtcgaaaaagcatatctgtacgctgaagatgctcatcgc
gagcaataccgcaaatcgggcgagccatatattattcatccgattcaggttgcggggatt
ctcgttgatcttgaaatggacccttccacaattgcgggcggatttctgcacgatgtcgtg
gaagatacagatgtgacgctcgatgacctgaaagaagcattttccgaagaagtggcaatg
cttgtggacggcgtaacgaagctcggtaaaattaaatataaatctcaagaggaacagcag
gcggaaaatcatcgcaaaatgtttgtcgctatggctcaagatatccgggtcatactgatc
aagctggcggatcgtctccacaatatgcggacgctgaaacatctgcctcaggaaaaacag
cggagaatttccaatgaaacactggagatttttgctcctttggcgcatcgtctcgggatt
tcaaaaattaagtgggaattggaagatacggcgctccgttatttgaatcctcagcaatat
tacagaattgtcaacctcatgaagaagaaacgcgcagaacgtgagctttatgtcgatgag
gttgtcaatgaagtgaagaaacgtgtcgaagaagtgaacatcaaggctgacttctcggga
cgtccgaaacatatttatagcatttatcgcaaaatggtgctgcaaaataagcaattcaac
gaaatttacgatttgctggctgttcgtattcttgtgaatagcataaaggactgctatgcg
gtgctcggcatcattcacacatgctggaagccgatgcccggcagattcaaagattatatc
gcaatgccgaagccgaatatgtatcaatcgcttcatacaacggttatcgggcccaaaggc
gatccgctggaagtgcagattcgcacctttgaaatgcatgaaattgcggaatacggggtt
gcggctcactgggcttataaagaagggaaagcggccaacgaaggcgcaacctttgagaaa
aagctttcttggttccgtgaaattttagaatttcaaaatgaatcaacagatgcagaagaa
tttatggaatcgctcaaaatcgatttgttttctgacatggtgtatgtttttacaccgaaa
ggagatgtaatcgagcttccgtccggttctgttccgattgatttttcttaccggattcac
tcggaaatcggcaataaaacaatcggtgccaaagtaaacggaaaaatggtaacgctggac
cataagcttcggacaggtgatatcgttgaaattctcacctctaagcattcctacggtccg
agccaggattgggtcaagcttgcgcaaacatcccaggcgaagcataagatccgtcaattc
tttaagaaacagcggcgcgaagaaaatgtcgaaaaaggccgtgagctggtcgaaaaagaa
attaaaaatctggatttcgaagtgaaggaagtcttaacgccggaaaatatccagaaggtt
gctgacaagtttaatttctcaaatgaagaggatatgtacgcagcggtcggctacaacggc
attacagccttacaggtggcaaaccgcctgacagaaaaagagagaaagcagcgcgatcag
gaagaacaggaaaagatcgttcaagaagtcaatgcggaacctaaaccatacccgcagggc
agaaaacgggaagcgggcgttcgtgtcaagggcatcgacaatcttcttgtccgtttgtca
aaatgctgcaatcctgtaccgggtgacgatattgtcggatttatcacaaaaggcagaggg
gtttcggtccatcgtgaagactgtccgaatgtcaaaacgaatgaagcccaggagcggctg
atcccggtagagtgggaacatgagtcacaggttcaaaagcgcaaggaatacaatgttgag
atagagattcttggttatgaccgccgcggattgctgaacgaggtgctgcaggcagtaaat
gaaacgaaaacaaatatttcatccgtctctggcaaatcggatcgcaataaagtggcaacc
attcatatggcgatttttattcagaacattaatcacttgcacaaagtcgtcgagcgtatt
aaacagataagagatatctattctgtgcgccgcgtcatgaactaa

DBGET integrated database retrieval system