KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_3057Help
Entry
GYO_3057          CDS       T01635                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GYO_3057 (hemB)
Enzymes [BR:bst01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     GYO_3057 (hemB)
Exosome [BR:bst04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GYO_3057 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2820124..2821098)
Genome map
AA seq 324 aa AA seqDB search
MSQSFNRHRRLRSSKAMREMVKETRLHPSDFIYPIFVVEGLEGKKAVPSMPDVYHVSLDL
LKDEVAELVKLGIQSVIVFGIPEEKDDCGTQAYHDHGIVQKAITEIKTHFPEMVVVADTC
LCEYTDHGHCGLVKDGVILNDESLELLAQTAVSQAKAGADIIAPSNMMDGFVTVIRKALD
KEGFVNIPIMSYAVKYSSEFYGPFRDAANSTPQFGDRKTYQMDPANRMEALREAQSDVEE
GADFLIVKPSLSYMDIMRDVKNEFTLPLVAYNVSGEYSMVKAAAQNGWIKEKEIVLEILT
SMKRAGADLIITYHAKDAAKWLAE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatcatttaacagacaccgccgcctgcggtcatcaaaagcaatgagagagatg
gtaaaggaaacacgtttgcacccatcggattttatttatccaatttttgtcgttgaaggg
ctggaaggcaaaaaagctgttccgtcaatgcctgatgtttaccatgtatcattagatcta
ctgaaggatgaagtggcagagctggttaaactgggcattcaatctgtcatcgtgttcggc
atcccggaagaaaaagatgattgcggaacgcaagcgtatcatgatcacggcatcgttcaa
aaagccatcacagaaattaaaacacacttccctgagatggttgttgtcgctgatacgtgc
ttatgcgaatatacagaccacggccattgcggacttgtcaaagacggcgtcatcctcaat
gatgaatcgctggagcttttggcgcagacagctgtcagccaagcgaaagcaggtgcggat
atcattgcgccttcaaacatgatggacggatttgttacagtgatcagaaaagcgcttgat
aaagaagggttcgtcaatattccaatcatgtcttacgctgtgaaatattcaagtgagttt
tacggtccgttccgtgatgcagcaaacagcacgccgcaattcggagaccgcaaaacatat
cagatggaccctgccaaccgtatggaagcactccgcgaagcacaatcagatgtcgaggaa
ggcgcggactttttgattgtcaaaccttcactttcatatatggatatcatgcgtgacgta
aaaaatgagtttactttgccgctcgtcgcttataatgtaagcggagagtattcaatggta
aaggctgcagcgcagaacggctggatcaaagaaaaggaaattgtgttagaaattttgaca
agcatgaagcgtgcaggtgctgacctgattattacgtatcatgccaaagacgcagcgaaa
tggcttgcggagtaa

DBGET integrated database retrieval system