KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_3058Help
Entry
GYO_3058          CDS       T01635                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GYO_3058
Enzymes [BR:bst01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     GYO_3058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2821095..2821883)
Genome map
AA seq 262 aa AA seqDB search
MENDFPLKGKTVLVTRNKAQAKSFQQKVEALGGKAVLTSLITFRRALPNNLAKQVKEDLA
APGWLVFTSVNGADFFFSYLKENQLILPAHKKIAAVGEKTARRLETHNVSVDVMPKDYIA
EQLAEALKQHAELAERITVVKGNLSRDVIKQELVPLGFKVKEWVVYETIPDEDGIEALKK
VAGQYSFDYVTFTSSSTVHTFMHVLGEELKKWQANRSVCISIGPLTRDALLTYGITSHTP
DTFTIDGMLELMCSMSREEERI
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgattttccgctgaaaggaaaaacagtgcttgtcacccggaataaggcgcag
gcaaaatcgtttcagcaaaaagtggaggcacttggcggaaaagcggttttgacctctttg
attacgtttcgccgcgctttgccgaataatcttgcaaaacaggtgaaagaggatcttgcc
gcccccggctggcttgtttttacaagtgtgaacggagcagacttctttttttcttattta
aaggaaaatcagctaattcttccagcgcataaaaaaattgcagctgtcggtgagaaaacg
gctcgccgtttggaaacgcataacgtatcggttgatgtgatgcctaaggactatatcgct
gaacagttggcggaggctcttaagcagcatgctgaactggcggaacggattacagtggtg
aaaggcaatttgtcacgtgatgtgataaaacaggagcttgtcccgctcggatttaaagtg
aaagaatgggttgtctacgaaacgattccggatgaagatggcatcgaggcactgaaaaag
gttgcgggccaatattcatttgactatgtgacatttacgagttcatcaaccgtacatacg
tttatgcatgtcttgggggaagaattgaaaaagtggcaggcgaacagatcggtctgtatc
agcatcggacctttaacaagggacgctctgctgacgtatggcatcacatcgcatacgcct
gatacatttacaatagatggcatgcttgagttaatgtgcagcatgtcaagagaggaagag
agaatatga

DBGET integrated database retrieval system