KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_3133Help
Entry
GYO_3133          CDS       T01635                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GYO_3133
Enzymes [BR:bst01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     GYO_3133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2898172..2899257)
Genome map
AA seq 361 aa AA seqDB search
MAKLDETLTMLKDLTDAKGIPGNEREVRQVMKSYIEPFADEVTTDRLGSLIAKKTGVQNG
PKIMIAGHLDEVGFMVTQITDKGFIRFQTVGGWWAQVMLAQRVTIVTKKGEITGVIGSKP
PHILSPEARKKSVEIKDMFIDIGASSREEALEWGVIPGDMIVPHFEFTVMNNEKFLLAKA
WDNRIGCAIAIDVLRNLQNTDHPNIVYGVGTVQEEVGLRGAKTAAHTIQPDIAFGVDVGI
AGDTPGISEKEAQSKMGKGPQIIVYDASMVSHKGLRDVVVATAEEAGIPYQFDAIAGGGT
DSGAIHLTANGVPALSITIATRYIHTHAAMLHRDDYENAVKLITEVIKKLDRKTVDQITY
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattagatgaaacattgaccatgctgaaagatttaacagatgcaaaaggcata
ccgggcaatgagagagaagtaaggcaagtgatgaaatcatacatagaaccatttgctgat
gaggtgacaacagatcggctgggcagtttaattgccaaaaaaacaggtgtgcaaaacggc
ccgaaaattatgatcgccgggcatttggacgaagtcggctttatggtgacacaaatcacc
gataaaggctttatccgttttcaaaccgttggcggctggtgggctcaggttatgctggcc
cagcgtgtcaccatcgtgacaaaaaaaggcgaaatcacaggggttatcggctccaagccg
ccgcatattttatctcctgaagcgagaaaaaaatcagtggaaataaaagacatgtttatt
gatattggagcttcaagccgagaagaagccttggaatggggtgtaatcccgggagatatg
atcgtacctcattttgaatttacggtcatgaacaatgaaaaattcttactggcgaaggcc
tgggacaaccgcattggctgtgcgattgcaattgatgtgttaagaaacttacaaaataca
gatcatccaaacattgtgtatggtgtcggaaccgtgcaggaggaagttggcctgagggga
gcgaaaacggctgcgcataccattcagcctgatattgcgtttggtgttgatgtaggaata
gcaggagacacgcctggcatttccgagaaggaagcgcaaagcaaaatgggtaaaggcccg
cagattatcgtttacgatgcatccatggtctctcataaaggcttgcgcgatgtagttgtc
gctaccgcagaggaagcaggcattccgtaccagtttgatgccatcgccggcggcggaaca
gattcgggagccatccatttgacggcaaatggcgttcctgcgctctctattaccattgca
acccgctacattcatacgcacgcggccatgctgcaccgtgatgattatgaaaacgcggtc
aaattaattacagaagtgattaagaaattagaccgaaagacagttgaccaaatcacatat
gaataa

DBGET integrated database retrieval system