KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_3133Help
Entry
GYO_3133          CDS       T01635                                 

Definition
(GenBank) YsdC
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2898172..2899257)
Genome map
AA seq 361 aa AA seqDB search
MAKLDETLTMLKDLTDAKGIPGNEREVRQVMKSYIEPFADEVTTDRLGSLIAKKTGVQNG
PKIMIAGHLDEVGFMVTQITDKGFIRFQTVGGWWAQVMLAQRVTIVTKKGEITGVIGSKP
PHILSPEARKKSVEIKDMFIDIGASSREEALEWGVIPGDMIVPHFEFTVMNNEKFLLAKA
WDNRIGCAIAIDVLRNLQNTDHPNIVYGVGTVQEEVGLRGAKTAAHTIQPDIAFGVDVGI
AGDTPGISEKEAQSKMGKGPQIIVYDASMVSHKGLRDVVVATAEEAGIPYQFDAIAGGGT
DSGAIHLTANGVPALSITIATRYIHTHAAMLHRDDYENAVKLITEVIKKLDRKTVDQITY
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattagatgaaacattgaccatgctgaaagatttaacagatgcaaaaggcata
ccgggcaatgagagagaagtaaggcaagtgatgaaatcatacatagaaccatttgctgat
gaggtgacaacagatcggctgggcagtttaattgccaaaaaaacaggtgtgcaaaacggc
ccgaaaattatgatcgccgggcatttggacgaagtcggctttatggtgacacaaatcacc
gataaaggctttatccgttttcaaaccgttggcggctggtgggctcaggttatgctggcc
cagcgtgtcaccatcgtgacaaaaaaaggcgaaatcacaggggttatcggctccaagccg
ccgcatattttatctcctgaagcgagaaaaaaatcagtggaaataaaagacatgtttatt
gatattggagcttcaagccgagaagaagccttggaatggggtgtaatcccgggagatatg
atcgtacctcattttgaatttacggtcatgaacaatgaaaaattcttactggcgaaggcc
tgggacaaccgcattggctgtgcgattgcaattgatgtgttaagaaacttacaaaataca
gatcatccaaacattgtgtatggtgtcggaaccgtgcaggaggaagttggcctgagggga
gcgaaaacggctgcgcataccattcagcctgatattgcgtttggtgttgatgtaggaata
gcaggagacacgcctggcatttccgagaaggaagcgcaaagcaaaatgggtaaaggcccg
cagattatcgtttacgatgcatccatggtctctcataaaggcttgcgcgatgtagttgtc
gctaccgcagaggaagcaggcattccgtaccagtttgatgccatcgccggcggcggaaca
gattcgggagccatccatttgacggcaaatggcgttcctgcgctctctattaccattgca
acccgctacattcatacgcacgcggccatgctgcaccgtgatgattatgaaaacgcggtc
aaattaattacagaagtgattaagaaattagaccgaaagacagttgaccaaatcacatat
gaataa

DBGET integrated database retrieval system