KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_3172Help
Entry
GYO_3172          CDS       T01635                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GYO_3172 (pfkA)
   01230 Biosynthesis of amino acids
    GYO_3172 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYO_3172 (pfkA)
   00030 Pentose phosphate pathway
    GYO_3172 (pfkA)
   00051 Fructose and mannose metabolism
    GYO_3172 (pfkA)
   00052 Galactose metabolism
    GYO_3172 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    GYO_3172 (pfkA)
Enzymes [BR:bst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GYO_3172 (pfkA)
Protein phosphatases and associated proteins [BR:bst01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GYO_3172 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2934723..2935682)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYAGLISGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMHEIIARLKRGHERGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSAADRVLASRLGAYAVELLLEGKGGRCVGIQNNKLVDHDIIEIL
DTKHTVEQNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtataggggtattaacgagcggcggggattccccgggaatgaacgcagcagtt
cgcgcagtagtcagaaaagcgatttatcatgacgttgaagtgtacggcatttacaacgga
tacgcaggattgatcagcggaaagattgaaaagcttgagctcggatctgtaggcgatatt
atacatcgcggaggaacaaagctttatacggcaagatgtcctgaattcaaaacggttgaa
ggccgtgaaaaagggatagaaaacttgaaaaagcttggtattgaaggtcttgttgtcatc
ggcggagacggttcctatatgggtgcgaaaaaattaacagaacatgggtttccatgtgta
ggtgtaccgggtacaattgataatgacattccgggcactgattttacaatcggtttcgat
acagctttaaatacagtaattgacgcaattgataagattcgcgatacagcgacttctcat
gaacgtacatatgtgatcgaagtaatgggccgccatgccggtgatatcgcattgtgggcc
ggtcttgcagggggcgcggaatcaatcttaatccctgaggcagactatgacatgcacgaa
atcattgcccgcttaaaacgcggccacgaacgcggcaagaaacacagtattattatcgtt
gccgaaggtgtaggcagcggtgttgaattcgggaaacgcattgaagaagaaacaaatctt
gaaactagggtatctgtactgggccatatccagcgcggaggttctccaagcgctgctgac
cgcgtgctggcaagccgtcttggcgcatatgctgttgaactgctgctagaaggaaaaggc
ggacgctgtgtaggtatacaaaacaataagcttgtagaccatgatattatagaaatactg
gatacaaaacacacagttgagcaaaacatgtatcagctttcaaaagaactgtctatttaa

DBGET integrated database retrieval system