KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_3246Help
Entry
GYO_3246          CDS       T01635                                 

Definition
(GenBank) YtjP
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst00300  Lysine biosynthesis
bst01100  Metabolic pathways
bst01120  Microbial metabolism in diverse environments
bst01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    GYO_3246
Enzymes [BR:bst01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     GYO_3246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 Peptidase_M28 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AEP87848
UniProt: G4NZL9
Position
complement(3004622..3006013)
Genome map
AA seq 463 aa AA seqDB search
MNWEVEVIRKKEDLIRDTQEFLRINSVMDETTAGPGKPFGEGVNASLTSLLKLGEKEGFT
TKNLDGFAGHIEWGEGDDIVGVLCHVDVVPPGDGWTSDPFSADIRNGRIYARGAIDDKGP
TMAAFYALKIVKDMNLPLSKRVRIIIGTDEESDWRCVEHYFKHEEMPTLGFAPDADFPII
NAEKGIIDASLLIPHRSNQADSETVLVSFQSGLRLNMVPDAAEAVIEGPKKEEILASFKD
MLRTTDQKGEAEIENGQLILRMYGLSCHAMEPNNGINAGLLLCKFLQQAKLDEAGQRFVQ
VVTDKFSDDTRGKKLNIDCEDDISGELTLNVGTLRYTEGQGGELGINIRYPVTAESKAIR
DAFESASEFELGEFKDSKPHHVSADHPLVKTLQKVYEGQLGKKADLISIGGGTYARSLKA
GVAFGPLFPGRPDSAHQKDEYIEIDDLLRSTALYAQAIYELAK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggaagtcgaagtgattagaaaaaaagaggatttaattcgtgatacgcaggaa
tttttgagaatcaacagtgtaatggacgaaacaaccgccggacctggcaagccgtttgga
gaaggagtaaatgccagcttgacttcattgttgaagctcggagaaaaagaaggctttaca
acaaaaaatcttgacggctttgcgggccatattgaatggggcgaaggcgatgacattgtt
ggcgtactttgccatgttgacgtcgtgccgccaggagatgggtggacgagtgatccgttt
tcagctgatatccgtaacggacggatttatgcaagaggcgccattgatgataaaggtccg
acgatggctgcgttctacgcgctgaaaatcgtgaaagatatgaatctgccgctgtccaag
cgtgtcagaatcattatcggaacagatgaagaaagcgattggagatgtgtggagcattat
ttcaagcatgaagaaatgccaacgctgggatttgcgcctgacgccgattttccaattatt
aacgcggaaaaagggatcattgatgcctcactactgatcccgcaccgctcaaaccaagcc
gattcagaaacagtgcttgtctcatttcagtcaggccttcgcttgaacatggtgcctgat
gctgcggaagctgtcattgaagggccgaaaaaagaagagattcttgcttcatttaaagac
atgctgcgcacgacagatcaaaaaggggaagctgaaatagaaaacggacagctcattttg
cgtatgtacgggctttcctgccatgcgatggaaccgaacaatgggatcaatgccggcctt
ttattgtgcaaatttctgcagcaggctaagcttgatgaagcaggacagcggtttgtgcaa
gtcgtgacagacaagttttcagacgatacgagagggaagaaactgaatatcgactgtgag
gatgacattagcggggagctgacattaaatgtcgggacactgcgctatacggaagggcaa
ggaggcgagctcggtatcaatatccgctatcctgttaccgcagaaagcaaagcgatccgc
gatgcattcgaaagcgcatctgaatttgagctgggagaattcaaagacagcaagccgcat
cacgtgtcagcagaccatccgttagtcaaaacccttcaaaaggtttatgaaggccagttg
ggcaaaaaagctgatttaatctcaatcggcggggggacttatgctagatctttaaaagcc
ggtgtcgcgttcggcccgctgttccccggacgtcctgacagcgcacatcaaaaggatgaa
tatatcgaaatcgatgatttgcttagatcgacagctttatatgcgcaggcgatctatgaa
cttgcaaaataa

DBGET integrated database retrieval system