KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_3246Help
Entry
GYO_3246          CDS       T01635                                 

Definition
hypothetical protein
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bst01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bst00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3004622..3006013)
Genome map
AA seq 463 aa AA seqDB search
MNWEVEVIRKKEDLIRDTQEFLRINSVMDETTAGPGKPFGEGVNASLTSLLKLGEKEGFT
TKNLDGFAGHIEWGEGDDIVGVLCHVDVVPPGDGWTSDPFSADIRNGRIYARGAIDDKGP
TMAAFYALKIVKDMNLPLSKRVRIIIGTDEESDWRCVEHYFKHEEMPTLGFAPDADFPII
NAEKGIIDASLLIPHRSNQADSETVLVSFQSGLRLNMVPDAAEAVIEGPKKEEILASFKD
MLRTTDQKGEAEIENGQLILRMYGLSCHAMEPNNGINAGLLLCKFLQQAKLDEAGQRFVQ
VVTDKFSDDTRGKKLNIDCEDDISGELTLNVGTLRYTEGQGGELGINIRYPVTAESKAIR
DAFESASEFELGEFKDSKPHHVSADHPLVKTLQKVYEGQLGKKADLISIGGGTYARSLKA
GVAFGPLFPGRPDSAHQKDEYIEIDDLLRSTALYAQAIYELAK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggaagtcgaagtgattagaaaaaaagaggatttaattcgtgatacgcaggaa
tttttgagaatcaacagtgtaatggacgaaacaaccgccggacctggcaagccgtttgga
gaaggagtaaatgccagcttgacttcattgttgaagctcggagaaaaagaaggctttaca
acaaaaaatcttgacggctttgcgggccatattgaatggggcgaaggcgatgacattgtt
ggcgtactttgccatgttgacgtcgtgccgccaggagatgggtggacgagtgatccgttt
tcagctgatatccgtaacggacggatttatgcaagaggcgccattgatgataaaggtccg
acgatggctgcgttctacgcgctgaaaatcgtgaaagatatgaatctgccgctgtccaag
cgtgtcagaatcattatcggaacagatgaagaaagcgattggagatgtgtggagcattat
ttcaagcatgaagaaatgccaacgctgggatttgcgcctgacgccgattttccaattatt
aacgcggaaaaagggatcattgatgcctcactactgatcccgcaccgctcaaaccaagcc
gattcagaaacagtgcttgtctcatttcagtcaggccttcgcttgaacatggtgcctgat
gctgcggaagctgtcattgaagggccgaaaaaagaagagattcttgcttcatttaaagac
atgctgcgcacgacagatcaaaaaggggaagctgaaatagaaaacggacagctcattttg
cgtatgtacgggctttcctgccatgcgatggaaccgaacaatgggatcaatgccggcctt
ttattgtgcaaatttctgcagcaggctaagcttgatgaagcaggacagcggtttgtgcaa
gtcgtgacagacaagttttcagacgatacgagagggaagaaactgaatatcgactgtgag
gatgacattagcggggagctgacattaaatgtcgggacactgcgctatacggaagggcaa
ggaggcgagctcggtatcaatatccgctatcctgttaccgcagaaagcaaagcgatccgc
gatgcattcgaaagcgcatctgaatttgagctgggagaattcaaagacagcaagccgcat
cacgtgtcagcagaccatccgttagtcaaaacccttcaaaaggtttatgaaggccagttg
ggcaaaaaagctgatttaatctcaatcggcggggggacttatgctagatctttaaaagcc
ggtgtcgcgttcggcccgctgttccccggacgtcctgacagcgcacatcaaaaggatgaa
tatatcgaaatcgatgatttgcttagatcgacagctttatatgcgcaggcgatctatgaa
cttgcaaaataa

DBGET integrated database retrieval system