KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_3279Help
Entry
GYO_3279          CDS       T01635                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bst00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bst00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bst00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3038623..3039921
Genome map
AA seq 432 aa AA seqDB search
MKKITFIGAGSTIFAKNVLGDCLLTEALNGFEFALYDIDPKRLQESQFMLENLRDRYNPS
VAINSYDDRKLALQNASYVINAIQVGGYKPSTVIDFEIPKRYGLRQTIADTVGIGGIFRS
LRTIPVLFDIAKDMEEMCPDAWFLNYTNPMASLTGAMLRYTNIKTIGLCHSVQVCTKDLF
KSLGMEHGGIEERIAGINHMAWLLEVKKDGVDLYPEIKRRAKEKQKTKHHDMVRFELMDK
FGYYVTESSEHNAEYHPYFIKRNYPELISELQIPLDEYPRRCVKQIQNWEKMRDDIVNNK
NLTHERSKEYGSRIIEAMETNEPFTFGGNVLNTGLITNLPSKAVVEVTCVADRKKITPCF
AGELPEQLAALNRTNINTQLMTIEAAVTRKKEAVYQAAMLDPHTSAELSMTDIISMCDDL
FAAHGDWLPEYK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattacatttatcggtgcagggagcaccattttcgccaaaaatgttttggga
gactgcttgttaacagaagcactgaatggatttgaattcgccctttacgacattgatcca
aaacgcttgcaggaatcccagttcatgctcgaaaatctgagagaccgctataacccgagt
gtggccatcaacagctatgatgacagaaaactcgccttgcagaacgcaagctatgtcatc
aatgcgattcaggttggagggtataaaccgagcacagtcatagatttcgagattccgaaa
cggtacgggctgcgtcagacgatcgctgacacagtcggcatcggcgggatcttcagatca
ctcagaacaatcccggtcttatttgatatcgcaaaagatatggaggaaatgtgcccggat
gcgtggtttttaaactacacaaacccaatggcctcacttacaggcgccatgctccgctat
acgaatatcaaaacaatcgggctctgccacagtgttcaagtgtgcacgaaggatttattc
aaatctctcggaatggagcatggcggaatcgaggagcgcatcgcgggcatcaatcatatg
gcttggcttttggaagtcaaaaaagacggcgtagatctatatccggaaatcaaaaggagg
gcaaaagaaaaacaaaaaacaaagcatcatgatatggtgcggtttgaattgatggataag
ttcggctattatgtcacggaatcatccgaacacaatgcagaatatcatccatactttatt
aaacggaactatcccgagctgatcagcgagctgcaaatcccgctcgacgaatatccgaga
agatgcgtgaaacagattcaaaattgggagaaaatgcgggatgatatcgttaataataaa
aaccttacgcacgaacgctcaaaggaatatggttcaagaattatagaagcaatggaaacg
aacgagccgttcacctttgggggaaacgtcttgaatacaggactgatcaccaatcttcct
tcaaaagcggttgtggaagtgacatgcgtcgccgacagaaaaaaaattaccccgtgcttc
gccggagaactgcctgagcagcttgcagccttaaaccggacgaatattaatacgcagttg
atgacaattgaagccgctgttacacgaaaaaaagaagcggtttaccaagcggcaatgctt
gatccgcatacaagcgcggagctttccatgactgacatcatctccatgtgtgacgattta
tttgcagcacacggcgattggcttccggaatacaaataa

DBGET integrated database retrieval system