KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_3303Help
Entry
GYO_3303          CDS       T01635                                 

Definition
hypothetical protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    GYO_3303
Enzymes [BR:bst01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     GYO_3303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3061479..3062135)
Genome map
AA seq 218 aa AA seqDB search
MGDLPGQGTTTRARGHIRSFQEYIDEVDTWIDKARTFELPVFLLGHSMGGLVAIEWFKQQ
RNPRITGIILSSPCLGLQIKVNKALDLASRGLNVIAPSLKVDSGLSIDMATRNEDVIEAD
QNDSLYVRKVSVRWYRELLKTIESAMVPTDAFLRVPLLVMQAGDDKLVDKTMVIKWFSGV
ASHNKAYREWEGLYHEIFNEPEREDVFKAARAFTDQYI
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacttgccgggtcaggggacaaccacaagggccagaggtcatattcgctcattt
caagaatacattgatgaagtagatacttggatagataaagcacgaacctttgagctgccg
gtttttcttctcggtcacagcatgggcggcctggtcgcgattgaatggtttaaacagcaa
agaaatccccgtattacgggaattattttatcatcaccgtgtctcggactgcaaattaaa
gtcaataaagcgcttgaccttgcatccagaggcctgaatgtcatcgctccgtcgcttaag
gttgattcgggattatcaattgatatggcgacgcgtaatgaggacgtcatcgaggccgac
caaaatgactcgttatacgtcaggaaagtttctgtcagatggtacagagagcttttaaaa
actattgagtcagcgatggtgccgacagatgcgtttttacgagtgccgcttcttgtgatg
caggccggtgacgataagcttgttgacaaaacgatggtcattaagtggttttcaggtgta
gcttcccataataaagcgtacagagagtgggaagggctttatcatgaaatatttaatgaa
cccgaaagagaagatgtctttaaagcagcaagagcgtttactgatcaatatatttga

DBGET integrated database retrieval system