KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_3320Help
Entry
GYO_3320          CDS       T01635                                 

Gene name
luxS
Definition
S-ribosylhomocysteinase
Orthology
K07173  
S-ribosylhomocysteine lyase [EC:4.4.1.21]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Cysteine biosynthesis, methionine => cysteine
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GYO_3320 (luxS)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    GYO_3320 (luxS)
Enzymes [BR:bst01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.21  S-ribosylhomocysteine lyase
     GYO_3320 (luxS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3076342..3076815)
Genome map
AA seq 157 aa AA seqDB search
MPSVESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLL
AFTIRSHAEKYDHFDIIDISPMGCQTGYYLVVSGEPTPAEIVDLLEDTMKEAVEITEIPA
ANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgccttcagtagaaagttttgagcttgatcataatgcggttgttgctccatatgtaaga
cattgcggcgtgcataaagtaggaacagacggcgttgtaaataaatttgatatccgtttt
tgccagccaaataaacaggcgatgaagcctgacaccattcacacacttgagcatttgctc
gcgtttacgattcgttctcacgctgagaaatacgatcattttgatatcattgatatttct
ccaatgggctgccaaacaggctattatcttgttgtgagcggagagccgacaccagcggaa
atcgttgatctgcttgaagacacaatgaaggaagcggttgaaattaccgaaattccggct
gcgaatgaaaagcagtgcggccaagcgaaacttcatgatctggaaggcgctaaacgttta
atgcgtttctggctgtcacaggataaagaagaattgctaaaagtatttggctaa

DBGET integrated database retrieval system