KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_3679Help
Entry
GYO_3679          CDS       T01635                                 

Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Brite
Enzymes [BR:bst01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     GYO_3679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3403606..3404346)
Genome map
AA seq 246 aa AA seqDB search
MKVVTPKPFTFKGGDKAVLLLHGFTGNTADVRMLGRYLNERGYTCHAPQYEGHGVPPEEL
VHTGPEDWWKNVMDGYEYLKSEGYESIAACGLSLGGVFSLKLGYTVPIKGIVPMCAPMHI
KSEEVMYQGVLSYARNYKKFEGKNPEQIEEEMKEFEKTPMNTLKALQDLIADVRNNVDMI
YSPTFVVQARHDHMINTESANIIYNEVETDDKQLKWYEESGHVITLDKERDLVHQDVYEF
LEKLDW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgtgacaccaaaaccatttacatttaaaggcggagacaaagcggtgcttttg
ctgcatggctttacaggaaatacagcggatgtaagaatgctggggcgttacttgaatgaa
cggggctatacgtgccacgcgcctcaatatgaaggacacggcgtgccccctgaagaacta
gtacatacggggcctgaagactggtggaaaaacgtgatggatggctatgaatacttaaaa
tctgaaggctatgagagcattgctgcctgcggactgtcgcttggcggggttttttcgctg
aaattgggttacactgtacccataaagggaattgttccaatgtgcgcaccgatgcacatt
aagagtgaagaggtcatgtatcagggcgtcctttcatacgctcgcaattacaaaaaattc
gaggggaaaaacccggagcaaattgaagaggaaatgaaggaattcgaaaaaacgccgatg
aacactcttaaggcgctgcaagacttaattgccgatgtgcggaacaatgtcgatatgatt
tattcaccgacatttgtggtgcaggcacgtcatgatcacatgattaatactgaaagcgcc
aatattatttacaacgaagtggaaactgatgataaacagctgaaatggtacgaggaatca
gggcatgtcattacactcgacaaagaacgtgacctcgtccatcaggatgtgtatgaattt
ttagagaagctcgattggtaa

DBGET integrated database retrieval system