KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_3715Help
Entry
GYO_3715          CDS       T01635                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GYO_3715 (tpiA)
   01230 Biosynthesis of amino acids
    GYO_3715 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYO_3715 (tpiA)
   00051 Fructose and mannose metabolism
    GYO_3715 (tpiA)
   00562 Inositol phosphate metabolism
    GYO_3715 (tpiA)
Enzymes [BR:bst01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GYO_3715 (tpiA)
Exosome [BR:bst04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GYO_3715 (tpiA)
  Exosomal proteins of bladder cancer cells
   GYO_3715 (tpiA)
  Exosomal proteins of melanoma cells
   GYO_3715 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3436349..3437110)
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTLGEAVSFVEEVKSSIPAADKAEAVVCAPALFLEKLTSAVKGTDLK
VGAQNMHFEESGAFTGEISPVALNDLGVDYCVIGHSERREMFAETDETVNKKAHAAFKHG
IVPIICVGETLEEREAGKTNDLVADQVKKGLAGLSEEQVAASVIAYEPIWAIGTGKSSTA
KDANDVCAHIRKTVAESFSQEVADKLRIQYGGSVKPANIKEYMAESDIDGALVGGASLEP
QSFVQLLEEGQYE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccaattatcgccggtaactggaaaatgaacaaaacactcggcgaagctgtc
agcttcgttgaagaagtgaaatcttccattccagcagcagacaaagcggaagctgttgtt
tgcgcgccagcacttttcttagaaaagcttacttctgctgttaaaggcactgacctaaaa
gtcggcgcacaaaacatgcacttcgaagaaagcggcgcgttcacaggcgaaatcagcccg
gttgctcttaacgaccttggcgttgactactgcgtcatcggccactctgagcgccgtgaa
atgttcgctgaaactgatgaaacagttaacaaaaaagcacacgctgctttcaaacacggc
attgtgccgatcatctgtgtaggtgaaacgcttgaagagcgcgaagccggcaaaacaaat
gatcttgttgctgaccaagtgaaaaaaggccttgctggtctttctgaagaacaagttgct
gcttctgttattgcgtatgagccaatctgggcaatcggaacaggcaaatcttctacagca
aaagatgcgaacgacgtgtgtgcgcatatccgtaaaaccgtcgctgaaagcttcagccaa
gaagttgcagacaagcttcgcatccaatatggcggaagcgtaaagcctgcaaacattaaa
gaatatatggcagaatccgatattgacggtgctttggtcggcggcgcgagccttgagcca
cagtcattcgttcaattattggaggaaggtcaatatgagtaa

DBGET integrated database retrieval system