KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_3745Help
Entry
GYO_3745          CDS       T01635                                 

Definition
beta-galactosidase family protein (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bst00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3462306..3464369)
Genome map
AA seq 687 aa AA seqDB search
MMSKLEKTHVTGAKFMLHGGDYNPDQWLDRPDILADDIKLMKLSHTNTFSVGIFAWSALE
PEEGVYQFEWLDDIFERIHSIGGRVILATPSGARPAWLSQTYPEVLRVNASRVKQLHGGR
HNHCLTSKVYREKTRHINRLLAERYGNHPALLMWHISNEYGGECHCDLCQHAFREWLKSK
YDNSLKALNHAWWTPFWSHTFNDWSQIESPSPIGENGLHGLNLDWRRFVTDQTISFYENE
IIPLKELTPDIPITTNFMADTPDLIPYQGLDYSKFAKHVDVISWDAYPVWHNDWESTADL
AMKVGFINDLYRSLKQQPFLLMECTPSAVNWHNVNKAKRPGMNLLSSMQMIAHGSDSVLY
FQYRKSRGSSEKLHGAIVDHDNSPKNRVFQEVAKTGETLERLSEVVGTKRPAETAILYDW
ENHWALEDAQGFAKATKRYAQTLQQHYRTFWEHDIPVDVITKEQDFSPYKLLIVPMLYLI
SEDTISRLKTFTANGGALVMTYISGIVNEHDLTYTGGWHPDLQAIFGIEPLETDTLYPKD
RNAVSYRSQTYEMKDYATVIDVKTASAEAVYQEDFYARTPAVTSHQYQQGKAYFIGARLE
DQFHRDFYEGLITDLSLSPVFPVRHGKGVSVQARQDQDNDYIFVMNFTEEKQLVTFDHSV
KDMMTGDILSGDLTLEKYEVRIVVNTH
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcaaagcttgaaaaaacgcacgtaacaggggcaaaatttatgcttcacggagga
gactacaatcctgatcaatggctggatcgccctgatattttagccgatgatatcaagctg
atgaagctttctcatacgaatacgttttctgtcggcatttttgcatggagcgcgcttgag
ccagaggagggcgtataccaatttgaatggctggacgatatttttgaacggatccacagc
ataggcgggagggtcatattagcaacaccaagcggagctcgtcctgcctggctgtcgcaa
acctatcctgaagttttgcgcgtcaatgcctcccgtgtcaaacagcttcacggcggaagg
cacaaccactgcctcacatctaaagtctaccgtgaaaaaacacgtcacatcaatcggtta
ctagcagaacgatacggcaatcatcctgcgctgttaatgtggcatatttcaaatgaatac
ggaggagagtgccactgcgatctatgccagcatgctttcagggagtggctgaaatcgaaa
tatgacaacagcctcaaggcattgaaccatgcgtggtggactcctttttggagccacaca
ttcaatgactggtcacaaattgaaagcccttcgccgatcggtgaaaacggcttacacggc
ctgaacttagactggcgccggttcgtcacagatcaaacgatttcgttttatgaaaatgaa
atcattccgctgaaagaactgacgcctgatatccctatcacaacgaattttatggctgac
acaccggatttgattccgtatcagggcctagactacagcaaatttgcgaagcatgtcgat
gtcatcagctgggacgcttatccggtctggcacaatgactgggaaagcacagctgatttg
gcgatgaaggtcggctttatcaatgacctgtaccggagcctgaagcagcagcctttctta
ttaatggagtgtacgccaagcgcggtcaattggcataacgtcaacaaggcgaagcgcccg
ggcatgaatctgctgtcgtccatgcaaatgattgcccacggttcggacagcgttctctat
ttccaataccgtaaatcgcgcggatcatcagaaaaattgcacggggcaatagtagatcat
gacaatagcccgaagaaccgggtctttcaagaagtggccaaaaccggcgaaacattagaa
cggctgtccgaggttgtcggaacgaagaggcccgctgaaacggctattttatatgactgg
gaaaatcactgggcgctcgaggatgctcaggggtttgcgaaggcgacaaaacgttatgcg
caaacgcttcagcagcattaccgcacgttctgggaacacgatatccctgtcgacgtcatc
acaaaagaacaggatttttcaccatataaactgttgatcgtcccgatgctatatttaatc
agcgaagacaccatttcccgtttgaaaacgtttacggctaacggcggcgccttagtcatg
acatatatcagcgggattgtaaatgagcatgatttaacgtatacaggaggatggcatccg
gatttgcaagctattttcggaattgagcctcttgaaaccgacacgctatatccgaaggat
cgaaatgctgtcagctatcgcagccaaacatatgaaatgaaggactatgcaaccgtgatc
gatgtcaagaccgcatcagcagaagcggtgtatcaagaagatttttacgcgcgtacgcca
gcggtgacaagccatcaatatcaacagggcaaggcgtattttatcggtgcgcgtttggag
gatcaatttcaccgggatttttatgaagggctcatcacagacctgtctctttctcctgtt
tttccggttcggcatggaaaaggtgtctccgtacaagcgaggcaggatcaggataatgat
tatatttttgtcatgaattttacggaagaaaagcagttggtcacgtttgatcacagtgtg
aaggatatgatgacaggagacatattatcaggtgacctgacgctggaaaaatatgaagtc
agaattgtcgtaaatacacattag

DBGET integrated database retrieval system