KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_4427Help
Entry
GYO_4427          CDS       T01635                                 

Definition
firmicute fructose-1,6-bisphosphatase superfamily protein (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GYO_4427
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYO_4427
   00030 Pentose phosphate pathway
    GYO_4427
   00051 Fructose and mannose metabolism
    GYO_4427
  Energy metabolism
   00680 Methane metabolism
    GYO_4427
Enzymes [BR:bst01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     GYO_4427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4120950..4122875
Genome map
AA seq 641 aa AA seqDB search
MESKYLDLLAQKYDCEEKVVTEIINLKAILNLPKGTEHFVSDLHGEYQAFQHVLRNGSGR
VKEKIRDIFSGVIYDREIDELAALVYYPEDKLKLIKHDFDAKPALNEWYKETINRMIKLV
SYCSSKYTRSKLRKALPAQFAYITEELLYKTEQAGNKEQYYSEIIDQIIELGQADKLITG
LAYSVQRLVVDHLHVVGDIYDRGPQPDRIMEELINYHSVDIQWGNHDVLWIGAYSGSKVC
LANIIRICARYDNLDIIEDVYGINLRPLLNLAEKYYDDNPAFRPKAAENRPEAEIKQITK
IHQAIAMIQFKLESPIIKRRPNFNMEERLLLEKIDYDKNEITLHGKTYQLENTCFATVNP
EQPDQLLEEEAEVIDKLLFSVQHSEKLGRHMNFMMKKGSLYLKYNGNLLIHGCIPVDENG
NMETMMIEDKPYAGRELLDVFERFLREAFAHPEETDDLATDMAWYLWTGEYSSLFGKRAM
TTFERYFIKEKETHKEKKNPYYYLREDEATCRNILAEFGLNPDHGHIINGHTPVKEIEGE
DPIKANGKMIVIDGGFSKAYQSTTGIAGYTLLYNSYGMQLVAHKHFNSKAEVLSTGTDVL
TVKRLVDKELERKKVKETNVGEELLQEVAILESLREYRYMK
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
ttggaaagcaagtacttagatctactcgcacaaaaatacgattgtgaagaaaaagtagta
acagaaatcattaatttgaaagcgatactgaacctgccaaagggaactgagcattttgtc
agtgatttgcacggggagtatcaggcattccagcacgtgctgcgtaatggttcaggacga
gtcaaagagaagatacgcgacatcttcagcggtgtcatttacgatagagaaatcgatgaa
ttagcagcattggtctattatccggaagacaaactgaagttaatcaaacatgactttgat
gcgaaaccagcattaaacgagtggtataaagaaacgattaatcgaatgattaagctcgtt
tcatattgctcctccaagtatacccgctccaaattacgcaaagcactgcctgcccagttt
gcttatattacggaggagctgctatataaaacagaacaagctggcaacaaggagcaatat
tactccgaaatcattgatcagatcattgaacttggccaagctgataagctgatcaccggc
cttgcttacagcgttcagcgactggtggtcgaccatctgcatgttgtcggcgatatttac
gaccgcggaccacagccggacaggattatggaggagctgatcaactaccattcagtcgat
attcaatggggaaatcacgatgtcctttggatcggcgcctattccggttccaaagtgtgc
ctggccaatattatccgtatctgtgcccgctacgataaccttgatattattgaagacgtg
tacggcatcaacctgagaccgctgctgaacctggccgaaaaatattatgacgataatcca
gcatttcgcccaaaagcagccgaaaatagaccagaagcagagattaagcaaatcacaaaa
atccatcaagcgattgcgatgatccaattcaagcttgagagcccgattatcaagagacgg
ccgaactttaacatggaggaacggctgttactagagaagattgattatgataaaaatgaa
atcacgctgcatggaaaaacatatcagctggaaaacacctgctttgcgacagtgaatccg
gaacagccagatcagctattagaagaagaagcagaagtcatagacaagctgctattctct
gtccagcattccgaaaagctgggccgccatatgaattttatgatgaaaaaaggcagcctt
tatttaaaatataacggcaacctgttgattcacggctgtattcctgtcgacgaaaacggc
aatatggaaacgatgatgattgaggataaaccgtatgcgggccgtgagctactcgatgta
tttgaacggttcttaagagaagcgtttgcccatccggaagaaaccgatgacctggcgaca
gatatggcttggtatttatggacaggcgagtactcctccctcttcggaaaacgcgccatg
acaacatttgagcggtatttcatcaaagagaaggaaacgcataaagagaagaaaaacccg
tattattatttacgcgaagacgaggcaacctgccgaaacatcctggcagaattcggcctc
aatccagatcatggccatatcatcaacggccatacacccgtaaaagaaatcgaaggagaa
gacccaatcaaagcaaacggaaaaatgatcgtcatcgacggcggcttctccaaagcctat
caatccacaacaggcatcgccggctacacgctgctatacaactcctacggcatgcagctc
gtcgcccataaacacttcaactccaaggcagaagtcctaagcaccggaaccgacgtctta
acggtgaaacgattagtggacaaagagcttgagcggaagaaagtgaaggaaacgaatgtg
ggtgaggagttgttgcaggaagttgcgattttggagagtttgcgggagtatcggtatatg
aagtga

DBGET integrated database retrieval system