KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_4433Help
Entry
GYO_4433          CDS       T01635                                 

Definition
formaldehyde dehydrogenase (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bst01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:bst00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:bst00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4131768..4132979)
Genome map
AA seq 403 aa AA seqDB search
MTGNKAVVYKGKGTVAVEDIGYPELILKDGPGVPKANVNRKCEHGVILKVITTNICGSDQ
HMVRGRTTAPEGLVLGHEITGEVIETGRDVEFIKKGDIVSVPFNIACGRCVMCRTQKTHV
CLNVNPDRPGSAYGYVDMGGWVGGQSEYVMVPYADFQLLVFPDKEQALEKILDLTMLSDI
FPTGFHGAYTAGVQTGSTVYIAGAGPVGLAAAHSAQLLGASTVIVGDLNEDRLAQARSFG
CETVNVQKHDRLGEQIEQILGEPTVDAAVDCVGFEASGHGNQGEAPAAVLNSIMDVTQVG
GSLGIPGLYVTEDPGAKDAEAKTGSLKIRFGLGWAKAHTFVTGQTPAMTYNRNLMKAILS
GRAQIAKAVNATVISLDDAPKGYSDFDKGSAKKFVIDPHGTLK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttgactggaaacaaagcggttgtgtacaaaggcaaagggactgtagcggtggaggatatc
ggttatccggagttaatcttgaaggacgggcccggcgtcccgaaggcgaatgtgaatcga
aaatgtgagcatggggttattctcaaagtcattacaaccaacatttgcgggagcgaccag
catatggtcagaggccgcacaacggcgcctgaaggcttggtgctcgggcatgaaattacc
ggagaagtcattgaaacggggcgggacgtcgaatttatcaaaaaaggcgacattgtatcc
gttcctttcaatattgcctgcggacgctgtgtgatgtgcagaacgcagaaaacgcatgtg
tgcctgaatgtcaatccggaccggccgggatcggcttacggctacgtcgatatgggcggc
tgggtcggcggccagtctgaatacgtcatggtaccgtacgccgattttcagcttttggta
ttcccggataaagaacaggcgctagaaaaaattctcgatttgaccatgctgtccgacatt
tttccgaccggcttccacggggcgtacacagcgggcgtgcaaacaggatcgaccgtctat
atcgcaggagcgggacctgtcggcttagcagctgcacactccgcccagcttcttggcgct
tctacagtcattgtcggcgatctgaacgaagacagactggcacaggcgagaagcttcggc
tgtgaaacggttaacgtgcaaaaacacgaccgcctcggcgagcaaattgaacaaatatta
ggtgaaccaaccgttgatgccgcagtggactgtgtcggctttgaagcatccggacacggc
aaccaaggggaagcgccagccgccgtgctgaactcgatcatggacgtcactcaggtcggc
ggaagcctcggcattccgggcttatacgtgaccgaagatcccggtgcaaaggatgccgaa
gctaaaacaggctcactaaagatccgtttcggactcggctgggccaaagcccacaccttc
gtcaccggacaaacacccgccatgacatacaaccgcaatttgatgaaagcgatcctgagc
ggcagagcgcaaatcgcaaaagctgtcaacgccaccgttatatctctggacgacgctcca
aaaggctacagcgacttcgacaaaggctcagccaaaaaattcgtcatcgacccgcatggt
acattgaagtaa

DBGET integrated database retrieval system