KEGG   Bacillus subtilis subsp. subtilis 168: BSU15220Help
Entry
BSU15220          CDS       T00010                                 

Gene name
murG
Definition
UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC:2.4.1.227)
Orthology
K02563  
UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU15220 (murG)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     BSU15220 (murG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
1591540..1592631
Genome map
AA seq 363 aa AA seqDB search
MRIAISGGGTGGHIYPALAFIKEVQRRHPNVEFLYIGTENGLEKKIVERENIPFRSIEIT
GFKRKLSFENVKTVMRFLKGVKKSKSYLAEFKPDAVIGTGGYVCGPVVYAAAKMGIPTIV
HEQNSLPGITNKFLSKYVNKVAICFEEAKSHFPSEKVVFTGNPRASEVVSIKTGRSLAEF
GLSEDKKTVLIFGGSRGAAPINRAVIDMQDVLKTRDYQVLYITGEVHYEKVMNELKSKGA
ADNMVTKPFLHQMPEYLKAIDVIVARAGATTIAEITALGIPSVLIPSPYVTANHQEVNAR
SLGQHDAAIVLKETELSGEKLIEALDRIVLNEQTLKEMSERTKSLGVPDAAARLYSVLEE
LKK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgcaataagcggaggcggtacagggggacatatttatcctgctcttgctttt
attaaagaagtgcaaagacgtcatcctaatgtggaatttttatatatcggaacagaaaac
gggctggagaaaaaaattgttgagcgggagaatataccgtttcgttcaattgaaattaca
ggatttaaaagaaaattgtcatttgaaaatgtcaagactgtgatgcgttttctgaagggc
gtcaaaaagagtaaatcgtatttagcggaatttaagcccgatgccgtaattggaacgggc
ggttatgtatgtgggccggttgtctatgccgctgcgaaaatgggaattccgactattgtc
cacgaacaaaacagcctgccgggcatcacgaataagtttctttcaaaatatgttaataaa
gtagcgatttgttttgaagaagcgaaatcacattttcctagcgagaaagttgtatttacg
ggaaacccgagagcctctgaagtcgtctcaataaagacgggacgatcattggctgaattt
gggctttctgaagacaaaaaaacggtcttaattttcggcggaagccgaggcgctgcaccg
attaaccgcgctgtcattgacatgcaggatgtgctgaaaacaagagactatcaagtgctg
tatatcaccggtgaagttcactatgaaaaagtaatgaatgagctgaaaagcaagggtgcc
gctgataatatggtcacaaagccgtttcttcatcaaatgcctgagtatttaaaggccatt
gatgtcattgtggccagagccggtgcgacaacgattgccgaaattactgctctcggaatc
ccaagtgttctgatcccaagtccatatgtgacagcgaatcaccaggaggtcaatgcgagg
tctcttggccagcatgatgcggcgattgtactgaaagaaacagagctcagcggggagaag
ctgattgaagcgctagaccggattgtactgaatgagcaaacgttaaaggaaatgagcgaa
cgaacaaagtcactcggtgttcctgacgcggctgcccgtttatacagcgtactcgaggaa
ttaaaaaaatag

DBGET integrated database retrieval system