KEGG   Bacillus subtilis subsp. subtilis 168: BSU15160Help
Entry
BSU15160          CDS       T00010                                 

Gene name
pbpB
Definition
penicillin-binding protein 2B
Orthology
K08724  
penicillin-binding protein 2B
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU15160 (pbpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
1581947..1584097
Genome map
AA seq 716 aa AA seqDB search
MIQMPKKNKFMNRGAAILSICFALFFFVILGRMAYIQITGKANGEVLATKATEQHEKKRT
IEASRGSILDRKGKVIAEDTATYKLIAILDKKMTTDVKHPQHVVNKEKTAEALSKVINLD
KADILDILNKDAKQVEFGSAGRDITYSQKQKIEKMKLPGISFLRDTKRYYPNGVFASNLI
GYAEVDEETNEISGAMGLEKVLDKYLKERDGYVTYESDKSGWELPNSKNKITAPKNGDNV
YLTIDQKIQTFLEDSMTKVAQKYNPKKIMAAVVDPKTGKVLAMGQRPSFDPNKRDVTNYY
NDLISYAYEPGSTMKIFTLAAAMQENVFNANEKYKSGTFEVGGAPVKDHNNGVGWGPTTY
HDGVLRSSNVAFAKLAKEKLGYDRLNQYLHKFNFYQKTGIDLPGEVSSKINFKYEFDKAS
TAYGQASAVTPIQQIQAATAIANDGKMMKPYVIDHIVDPDKDKTIYQNKPESAGTPISAS
TAKKVRDILGEVVTSKIGTGQAYKIEGFDVAGKTGTAQIAGKGGYLDGTDNYIFSFMGMA
PKDDPELLIYVAVQQPQLKAGQSSSDPVSEIFNPTMKNSLHYLNIEPTEKSDSDKEETKA
QTMPDLTDQTVAAAQKKAKEENLTPIVIGSDVAVKEQYPKADEEVLTNQKVFLKTGGKIK
MPDMTGWSRREVLQYGELAGIHIEVSGQGYAVSQSVKKDKEIKDKTVIKVKFKNPD
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaatgccaaaaaagaataaatttatgaatagaggagcagcgattctaagtatt
tgtttcgctctctttttctttgtcatcctggggagaatggcatatattcaaataaccgga
aaagcgaacggcgaagtgcttgcgacaaaagcgacagagcagcatgaaaagaaacggacc
atcgaagcgagccgcggctcgattttagaccgaaaaggaaaagtcattgcagaggacaca
gcgacgtataaactgattgcgattctcgataaaaaaatgaccactgatgtcaagcatcct
cagcatgttgtaaacaaagaaaaaacggcggaagcattgtctaaagtgataaacttggac
aaggccgacatccttgatatcttaaataaagatgcaaaacaagtcgagtttggctcagct
ggccgggatattacgtattcacaaaagcaaaaaatcgaaaaaatgaaactcccgggcatt
tcatttttacgggatacaaaacgctactatccaaacggagtatttgcatctaatctaatc
ggctatgccgaggttgatgaagaaacaaatgaaatttccggcgcgatgggattagaaaaa
gtgctggataagtatttgaaggagcgggacggatatgtgacatatgaaagcgacaaatcc
ggctgggagctcccgaacagcaaaaataaaattacagcgccaaaaaatggtgacaatgta
tatttaaccattgaccagaaaattcaaacctttttggaagacagcatgacaaaagtggcg
caaaagtataatccgaaaaaaatcatggccgcagtcgttgatccgaaaacgggcaaagtc
cttgccatgggacagcgcccaagctttgatccgaacaagcgcgatgtgacaaactactat
aatgatttgatttcatatgcgtatgaacccgggtccacgatgaagatctttacactcgct
gctgcgatgcaggaaaacgtgtttaatgcgaacgaaaaatataaatcagggacatttgaa
gttggcggagcacctgttaaggatcacaataacggtgtaggctggggtccgacaacatat
catgacggcgtcctaaggtcgtcgaatgtcgcttttgcgaaactggcgaaagaaaagctg
ggatatgaccgcctcaatcaatatttgcacaaattcaatttttaccagaaaacaggtatt
gatttgccaggagaagtctccagcaaaatcaactttaaatatgaatttgataaggcgtca
actgcatatggccaagcgtctgcggtcacaccaattcagcagattcaggccgcaacggca
attgcaaatgacggtaaaatgatgaaaccttatgtcattgaccatatcgttgaccctgat
aaagataaaactatttatcaaaataagccggaatcagccggaactccaatttctgcaagt
actgcgaaaaaggtgcgggatatattaggagaagtcgttacatcgaagatcggaacaggg
caagcttataaaatcgaaggttttgatgttgccgggaaaacaggtactgcgcaaatagcc
ggtaaaggcggatatttagacggcacagataactatatcttttcgtttatgggtatggcg
ccaaaagatgatcctgagcttttaatttatgttgctgtacagcagccgcaactaaaagca
ggacaaagcagttcagatccagtatcagaaatcttcaatccaacaatgaaaaatagcctg
cactacctaaacatcgaaccaactgaaaaatctgactcagataaggaagaaacaaaagcg
cagacaatgcctgatttaacagatcaaacggtagctgctgctcaaaagaaagcaaaagag
gagaatctcacaccaattgtcatcggcagtgatgtcgctgtaaaagaacagtatccgaaa
gcggatgaggaagttctcaccaatcaaaaggtcttcctgaaaacgggcggcaaaatcaaa
atgcctgatatgacaggctggtcgagaagagaggttctgcagtacggcgagctcgcggga
attcatattgaagtaagcggacaaggctacgctgtcagccaaagtgttaagaaagacaaa
gaaatcaaagacaaaaccgtaatcaaggttaagtttaaaaatcctgattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system