KEGG   Bacillus subtilis subsp. subtilis 168: BSU34450Help
Entry
BSU34450          CDS       T00010                                 

Gene name
sacB
Definition
levansucrase (EC:2.4.1.10)
Orthology
K00692  
levansucrase [EC:2.4.1.10]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Starch and sucrose metabolism
Metabolic pathways
Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU34450 (sacB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BSU34450 (sacB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.10  levansucrase
     BSU34450 (sacB)
Glycosyltransferases [BR:bsu01003]
 Polysaccharide
  Bacterial polysaccharide
   BSU34450 (sacB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
3536012..3537433
Genome map
AA seq 473 aa AA seqDB search
MNIKKFAKQATVLTFTTALLAGGATQAFAKETNQKPYKETYGISHITRHDMLQIPEQQKN
EKYQVPEFDSSTIKNISSAKGLDVWDSWPLQNADGTVANYHGYHIVFALAGDPKNADDTS
IYMFYQKVGETSIDSWKNAGRVFKDSDKFDANDSILKDQTQEWSGSATFTSDGKIRLFYT
DFSGKHYGKQTLTTAQVNVSASDSSLNINGVEDYKSIFDGDGKTYQNVQQFIDEGNYSSG
DNHTLRDPHYVEDKGHKYLVFEANTGTEDGYQGEESLFNKAYYGKSTSFFRQESQKLLQS
DKKRTAELANGALGMIELNDDYTLKKVMKPLIASNTVTDEIERANVFKMNGKWYLFTDSR
GSKMTIDGITSNDIYMLGYVSNSLTGPYKPLNKTGLVLKMDLDPNDVTFTYSHFAVPQAK
GNNVVITSYMTNRGFYADKQSTFAPSFLLNIKGKKTSVVKDSILEQGQLTVNK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcaaaaagtttgcaaaacaagcaacagtattaacctttactaccgcactgctg
gcaggaggcgcaactcaagcgtttgcgaaagaaacgaaccaaaagccatataaggaaaca
tacggcatttcccatattacacgccatgatatgctgcaaatccctgaacagcaaaaaaat
gaaaaatatcaagttcctgaattcgattcgtccacaattaaaaatatctcttctgcaaaa
ggcctggacgtttgggacagctggccattacaaaacgctgacggcactgtcgcaaactat
cacggctaccacatcgtctttgcattagccggagatcctaaaaatgcggatgacacatcg
atttacatgttctatcaaaaagtcggcgaaacttctattgacagctggaaaaacgctggc
cgcgtctttaaagacagcgacaaattcgatgcaaatgattctatcctaaaagaccaaaca
caagaatggtcaggttcagccacatttacatctgacggaaaaatccgtttattctacact
gatttctccggtaaacattacggcaaacaaacactgacaactgcacaagttaacgtatca
gcatcagacagctctttgaacatcaacggtgtagaggattataaatcaatctttgacggt
gacggaaaaacgtatcaaaatgtacagcagttcatcgatgaaggcaactacagctcaggc
gacaaccatacgctgagagatcctcactacgtagaagataaaggccacaaatacttagta
tttgaagcaaacactggaactgaagatggctaccaaggcgaagaatctttatttaacaaa
gcatactatggcaaaagcacatcattcttccgtcaagaaagtcaaaaacttctgcaaagc
gataaaaaacgcacggctgagttagcaaacggcgctctcggtatgattgagctaaacgat
gattacacactgaaaaaagtgatgaaaccgctgattgcatctaacacagtaacagatgaa
attgaacgcgcgaacgtctttaaaatgaacggcaaatggtacctgttcactgactcccgc
ggatcaaaaatgacgattgacggcattacgtctaacgatatttacatgcttggttatgtt
tctaattctttaactggcccatacaagccgctgaacaaaactggccttgtgttaaaaatg
gatcttgatcctaacgatgtaacctttacttactcacacttcgctgtacctcaagcgaaa
ggaaacaatgtcgtgattacaagctatatgacaaacagaggattctacgcagacaaacaa
tcaacgtttgcgccaagcttcctgctgaacatcaaaggcaagaaaacatctgttgtcaaa
gacagcatccttgaacaaggacaattaacagttaacaaataa

DBGET integrated database retrieval system