KEGG   Bacillus subtilis subsp. subtilis 168: BSU00080Help
Entry
BSU00080          CDS       T00010                                 

Gene name
yaaC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(14847..15794)
Genome map
AA seq 315 aa AA seqDB search
MTYHEWKDLALFYSVESTQKFLEKVYILNGINDAKKNSFKNSERFIYFLKHAESFYKQAA
YSPLEIKPILLFYGMAQLIKACLITRDPHYPSHTSVLAHGVTTRKRKKQNYCFSDDEVKI
QRNGLCVHFMKHLFGQSDIVDERYTMKKLLMAIPELSDIFYFQQKERFMTKVEKDKNEIF
VPEEVVINYKMSDSRFAEYMSHHYQWSFTKKNEHGLLFEISPQDKEPWTSTSLLFDMEKN
QYYIPSQREQFLRLPEMTIHYLILYNVGMIARYETEWWYELLTQHISDDYVLIQQFLLVS
EKKFPKYASQFLLHF
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacatatcatgagtggaaagacttagcgctattttactccgttgaatcaacccagaaa
tttctagaaaaggtttatatcttaaacggtattaacgatgcgaaaaaaaactcttttaaa
aacagtgaacggtttatttatttcttaaagcatgccgaatcgttttataaacaagccgca
tattctcccttagaaatcaaaccgattcttttattttatggaatggcacagcttatcaaa
gcatgcttaattacacgtgatcctcattatccaagccatacatcagtactggcacatggc
gtaacaacaagaaaacgaaagaaacaaaattattgttttagcgacgatgaagtgaaaata
caacggaatggcctatgcgtacattttatgaaacatttattcggacaatcggatatagta
gatgaacggtataccatgaaaaaattattaatggccattccagaacttagcgatattttc
tactttcagcagaaagaacgatttatgacaaaagttgagaaggataagaacgaaattttt
gtaccggaggaagtagtaatcaattacaaaatgtctgattcaaggtttgctgaatacatg
tcccatcattatcaatggtcttttacaaaaaaaaatgaacacgggctgctgttcgaaatt
tcaccacaagacaaggagccatggacatcgaccagcttattgtttgacatggaaaagaac
caatattatatcccttctcaaagggagcaatttctgaggcttcccgaaatgacaattcat
tatttgattttgtacaacgttgggatgattgcaaggtatgaaacagaatggtggtatgag
ttattaacacagcatataagtgatgactacgtgttaattcagcagtttttattagtatca
gaaaagaaattccctaaatacgcttcacagtttcttcttcatttttaa

DBGET integrated database retrieval system