KEGG   Bacillus subtilis subsp. subtilis 168: BSU00140Help
Entry
BSU00140          CDS       T00010                                 

Gene name
dck
Definition
deoxyadenosine/deoxycytidine kinase (EC:2.7.1.74 2.7.1.76)
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BSU00140 (dck)
   00240 Pyrimidine metabolism
    BSU00140 (dck)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     BSU00140 (dck)
    2.7.1.76  2'-deoxyadenosine kinase
     BSU00140 (dck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(22496..23149)
Genome map
AA seq 217 aa AA seqDB search
MKEHHIPKNSIITVAGTVGVGKSTLTKTLAKRLGFKTSLEEVDHNPYLEKFYHDFERWSF
HLQIYFLAERFKEQKTIFEAGGGFVQDRSIYEDTGIFAKMHADKGTMSKVDYKTYTSLFE
AMVMTPYFPHPDVLIYLEGDLENILNRIEQRGREMELQTSRSYWEEMHTRYENWISGFNA
CPVLKLRIEDYDLLNDENSIENIVDQIASVIHDNQKK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaacatcatatccctaagaattcaattattacagtagcaggaacagtaggtgtc
ggaaaatcgactttaacaaaaactttagctaaacggcttggatttaaaacatcgttggag
gaagtcgatcataatccatatttggaaaagttctatcatgattttgaacgttggagcttt
caccttcaaatttacttcttagctgaacgcttcaaagaacagaaaacaatttttgaagcc
ggcggaggttttgtacaggatcgttcgatttatgaagatacaggaattttcgcaaaaatg
catgctgataaagggacaatgtcaaaggttgattataagacttacacaagccttttcgaa
gcaatggtaatgacaccgtatttcccacatccagatgtgttgatctatttagaaggagat
ctggagaacattttaaaccggattgaacaacgcggccgtgagatggagcttcagacaagc
cggtcttattgggaagaaatgcatacacgctacgagaactggataagcggttttaatgcc
tgccctgttttaaaacttcgcattgaagattatgatcttctgaacgacgaaaactcgatt
gaaaatattgtagatcaaattgcttcagttattcatgataatcaaaaaaagtga

DBGET integrated database retrieval system