KEGG   Bacillus subtilis subsp. subtilis 168: BSU00210Help
Entry
BSU00210          CDS       T00010                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bsu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
28867..29463
Genome map
AA seq 198 aa AA seqDB search
MQYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLGMKEDVVLDFAKALVNAKRNLTYCSVC
GHITDQDPCYICEDTRRDKSVICVVQDPKDVIAMEKMKEYNGQYHVLHGAISPMDGIGPE
DIKIPELLKRLQDDQVTEVILATNPNIEGEATAMYISRLLKPSGIKLSRIAHGLPVGGDL
EYADEVTLSKALEGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatcctgaaccaatatcaaagctgattgacagctttatgaaattgccagggatc
ggaccgaaaacagcggttcgtctggctttttttgttctaggtatgaaagaagatgtagta
ttagattttgcgaaagcattagtaaatgcgaaacgcaacctgacatattgttcagtttgc
gggcatattacagatcaggacccttgctatatatgtgaagatacgcgcagggataagtct
gttatctgtgttgtgcaagaccctaaagacgttatcgctatggagaaaatgaaggaatac
aacggacagtatcacgttcttcacggcgctatttctccaatggacggcatcggaccggag
gatattaaaataccagaattgttaaaacgattacaggatgatcaagtgacagaagtgatc
ctcgcgacaaaccctaatatagaaggggaagcaacagcgatgtatatatcaaggctcctc
aagccgtctggtattaagctctcccgtattgcccacggactgcccgtcggcggtgatttg
gaatatgctgatgaggtcactctttctaaagcacttgaaggaagacgtgaattgtaa

DBGET integrated database retrieval system