KEGG   Bacillus subtilis subsp. subtilis 168: BSU00310Help
Entry
BSU00310          CDS       T00010                                 

Gene name
holB
Definition
(RefSeq) DNA polymerase III subunit delta' (EC:2.7.7.7)
  KO
K02341  
DNA polymerase III subunit delta' [EC:2.7.7.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BSU00310 (holB)
   00240 Pyrimidine metabolism
    BSU00310 (holB)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BSU00310 (holB)
   03430 Mismatch repair
    BSU00310 (holB)
   03440 Homologous recombination
    BSU00310 (holB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BSU00310 (holB)
DNA replication proteins [BR:bsu03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BSU00310 (holB)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     BSU00310 (holB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
40665..41654
Genome map
AA seq 329 aa AA seqDB search
MAISWKEMNELQPRVMKLLYNSIEKDRLSHAYLFEGKKGTGKLDAALLLAKSFFCLEGGA
EPCESCRNCKRIESGNHPDLHLVQPDGLSIKKAQIQALQEEFSKTGLESHKKLYIISHAD
QMTANAANSLLKFLEEPNKDTMAVLITEQPQRLLDTIISRCQTLPFQPLQPKAIEDRLIE
QDVSPHMARLLANMTNNVAEAVELSRNDEFAESRAKVIKLYEVLHQRKGHAFFFIQDQWM
PFFKEKTHQEMGLDMLLLIYRDVLSIQIGNEDKLIYQDLFQSIKQHALQSTQQSVTNQIL
AVLEAKKRLHSNVNVQGLMEHLVLMLQEG
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcaatatcctggaaggaaatgaacgagcttcagcccagagtgatgaagcttttatat
aatagtattgagaaggacagactatcacacgcttatttgtttgaggggaaaaaaggaaca
ggcaagcttgatgccgcgctgcttcttgcaaaaagcttcttttgtctggagggtggcgcg
gagccttgtgagagctgccgaaactgtaaacggatagagtcagggaaccatcctgatctc
catcttgttcagcctgatggcttatcaatcaaaaaggcgcaaattcaagcgctccaagaa
gagttttctaagacaggacttgaatcgcataaaaagctgtatattatttcgcacgcagat
caaatgacagcaaatgcggcgaacagcctgctgaaatttttagaagaaccgaacaaagac
acaatggccgtcctcatcactgagcagccccaaaggttattggataccatcatttcaaga
tgccaaacccttccttttcagcctttgcagccgaaagcaattgaagacagactgatcgaa
caggacgtctcgcctcatatggcaaggcttctggccaacatgactaataatgtagcagaa
gcagtcgaattaagtcgaaatgatgagtttgcagagtctagagcgaaagtgataaaattg
tatgaagtcctacaccagcggaaaggacatgcttttttctttattcaagatcaatggatg
ccctttttcaaagaaaaaacccatcaagaaatgggtcttgatatgctcttattgatatat
cgtgatgtgttgtccatccaaataggaaatgaagataaattgatttatcaagacttattc
caatcaataaaacagcatgcgctacaatcaacacaacaaagcgttacgaatcagatactt
gctgttttagaagcaaagaaacggcttcattccaatgtgaatgtacaaggattaatggag
cacttggtgttaatgttgcaggagggataa

DBGET integrated database retrieval system