KEGG   Bacillus subtilis subsp. subtilis 168: BSU00420Help
Entry
BSU00420          CDS       T00010                                 

Gene name
ksgA
Definition
(RefSeq) ribosomal RNA small subunit methyltransferase A (EC:2.1.1.-)
  KO
K02528  
16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC:2.1.1.182]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.182  16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase
     BSU00420 (ksgA)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    BSU00420 (ksgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
50640..51518
Genome map
AA seq 292 aa AA seqDB search
MNKDIATPIRTKEILKKYGFSFKKSLGQNFLIDTNILNRIVDHAEVTEKTGVIEIGPGIG
ALTEQLAKRAKKVVAFEIDQRLLPILKDTLSPYENVTVIHQDVLKADVKSVIEEQFQDCD
EIMVVANLPYYVTTPIIMKLLEEHLPLKGIVVMLQKEVAERMAADPSSKEYGSLSIAVQF
YTEAKTVMIVPKTVFVPQPNVDSAVIRLILRDGPAVDVENESFFFQLIKASFAQRRKTLL
NNLVNNLPEGKAQKSTIEQVLEETNIDGKRRGESLSIEEFAALSNGLYKALF
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagatattgcgacaccgattagaacgaaagagatactgaagaaatacggtttt
tcttttaaaaagagcttaggacagaatttcttaattgatacgaacattttaaacagaatt
gttgatcacgcggaagtgacggagaaaacaggtgtcattgaaatcggcccgggaatcggg
gctttaaccgaacagcttgccaagcgggcgaaaaaggtcgtggcatttgagattgaccag
cgattattgccgattctgaaggatacactgtcaccttacgaaaatgtcactgtcattcat
caggacgtgttaaaggctgatgtcaaatcagtcattgaagaacaatttcaagattgtgat
gagatcatggtagttgccaaccttccttattacgtaacaacaccgattatcatgaaactg
cttgaagaacatcttccgctgaaagggattgtggttatgctgcaaaaagaagtggctgag
cgcatggcggctgatccttcatctaaggaatacggctcgctttcaatcgcggtgcagttt
tatacagaagccaaaacggtgatgatcgtcccgaaaaccgtatttgttcctcagcctaat
gtcgattccgcagtcattcgtctgattctccgagacggcccggcagtggacgtggaaaac
gaatcctttttctttcagctcatcaaggcaagctttgcacagcgccgtaaaacgctgctc
aataacttagttaacaatctgcctgaaggaaaagcacaaaaatcaacgattgaacaagtg
ctcgaagaaacaaatattgacggtaagcgccgaggtgaatccctgtctattgaggaattc
gcagcgctgtctaacggattgtataaagcccttttctaa

DBGET integrated database retrieval system