KEGG   Bacillus subtilis subsp. subtilis 168: BSU00770Help
Entry
BSU00770          CDS       T00010                                 

Gene name
sul
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bsu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
85737..86594
Genome map
AA seq 285 aa AA seqDB search
MAQHTIDQTQVIHTKPSALSYKEKTLVMGILNVTPDSFSDGGKYDSLDKALLHAKEMIDD
GAHIIDIGGESTRPGAECVSEDEEMSRVIPVIERITKELGVPISVDTYKASVADEAVKAG
ASIINDIWGAKHDPKMASVAAEHNVPIVLMHNRPERNYNDLLPDMLSDLMESVKIAVEAG
VDEKNIILDPGIGFAKTYHDNLAVMNKLEIFSGLGYPVLLATSRKRFIGRVLDLPPEERA
EGTGATVCLGIQKGCDIVRVHDVKQIARMAKMMDAMLNKGGVHHG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcacacaatagatcaaacacaagtaatccacactaagcccagcgctttatca
tataaagagaagacgctggtgatgggaattttaaacgtaacgcctgactctttctcggac
ggcggaaaatatgacagcttggacaaggcgctgctgcacgcgaaagagatgatcgatgat
ggtgcccatatcattgatattggaggggaatcgacaaggcctggcgctgagtgcgtatct
gaggatgaggagatgtccagagtcattccggtgattgagcggattacgaaagagcttggt
gttcctatttctgtagacacgtacaaggcttctgtcgcagatgaagcagtgaaagccggt
gcatccattatcaatgatatttggggagccaaacatgatccgaagatggcttccgttgca
gctgaacataatgttccaattgtactcatgcataaccgccctgaaagaaactacaatgac
ttattgccggatatgctgtcggacttaatggagagtgtaaaaattgctgttgaggccgga
gtagacgagaagaacattattcttgatcctggtatcggtttcgcgaaaacctatcacgat
aacttggcagtgatgaacaaactagagattttcagcggattgggatatccggttcttctg
gcaacctcccgaaaaagattcatcggacgtgttctggatcttccgcctgaggagcgggct
gagggcacaggcgcgactgtgtgtctcggcattcaaaaaggctgtgacattgtcagggtc
catgatgtaaagcaaattgccagaatggcgaaaatgatggacgcgatgctgaataaggga
ggggtgcaccatggataa

DBGET integrated database retrieval system