KEGG   Bacillus subtilis subsp. subtilis 168: BSU00810Help
Entry
BSU00810          CDS       T00010                                 

Gene name
dusB
Definition
(RefSeq) tRNA-dihydrouridine synthase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
BSORF: 
UniProt: 
Position
87634..88635
Genome map
AA seq 333 aa AA seqDB search
MFKIGDIQLKNRVVLAPMAGVCNSAFRLTVKEFGAGLVCAEMVSDKAILYNNARTMGMLY
IDEREKPLSLQIFGGKKETLVEAAKFVDQNTTADIIDINMGCPVPKITKCDAGAKWLLDP
DKIYEMVSAVVDAVNKPVTVKMRMGWDEDHIFAVKNAQAVERAGGKAVALHGRTRVQMYE
GTANWDIIKEVKQSVSIPVIGNGDVKTPQDAKRMLDETGVDGVMIGRAALGNPWMIYRTV
QYLETGKLKEEPQVREKMAVCKLHLDRLIDLKGENVAVREMRKHAAWYLKGVKGNANVRN
EINHCETREEFVQLLDAFTVEVEAKELQNAKVG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
ttgttcaaaatcggagatattcaattgaaaaaccgggttgtgctcgcacctatggctggt
gtctgcaactctgcgttcagattgactgtaaaggaattcggagccggattggtatgcgct
gaaatggtcagtgacaaagcgatcctttacaacaatgcaagaacaatgggtatgctttat
attgatgaacgtgagaaaccactgagccttcaaattttcggaggaaaaaaggaaaccctt
gtggaagcggcgaagtttgtagaccaaaacacaactgctgatatcattgatattaacatg
ggatgtcccgtgccgaagattacaaaatgcgatgcgggagccaaatggcttctcgatcct
gataagatttacgaaatggtttctgcagtagtggatgctgttaataagccagttacagtg
aaaatgagaatgggctgggatgaagaccacattttcgcagtgaaaaatgcacaggctgta
gaacgtgcgggcggtaaagcagtggcgcttcacggccgtacgagagtgcagatgtacgaa
ggaacggcaaactgggatatcatcaaagaagtaaaacaatcagtatcgattccggttatc
ggaaacggcgatgttaagacaccgcaggatgctaagcgtatgctcgatgagacaggagta
gacggggtcatgatcggacgcgctgcattgggtaacccgtggatgatttaccgtacggtt
cagtatcttgaaacaggtaaattaaaagaagagccgcaagtacgcgaaaaaatggccgta
tgcaaactgcatcttgaccgcctgattgacttaaaaggtgaaaacgtagcggtaagagaa
atgagaaagcacgctgcatggtatctgaaaggcgtgaaaggcaatgcgaacgttcgtaat
gaaatcaatcattgcgagacgagagaagagtttgtacagcttttagatgcatttacggtt
gaagttgaggcaaaagagcttcaaaatgcaaaagtaggataa

DBGET integrated database retrieval system