KEGG   Bacillus subtilis subsp. subtilis 168: BSU00860Help
Entry
BSU00860          CDS       T00010                                 

Gene name
clpC
Definition
(RefSeq) negative regulator of genetic competence ClpC/MecB
  KO
K03696  
ATP-dependent Clp protease ATP-binding subunit ClpC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Chaperones and folding catalysts [BR:bsu03110]
 Heat shock proteins
  HSP100
   BSU00860 (clpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
103572..106004
Genome map
AA seq 810 aa AA seqDB search
MMFGRFTERAQKVLALAQEEALRLGHNNIGTEHILLGLVREGEGIAAKALQALGLGSEKI
QKEVESLIGRGQEMSQTIHYTPRAKKVIELSMDEARKLGHSYVGTEHILLGLIREGEGVA
ARVLNNLGVSLNKARQQVLQLLGSNETGSSAAGTNSNANTPTLDSLARDLTAIAKEDSLD
PVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQQIINNEVPEILRDKRVM
TLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDELHTLIGAGGAEGAIDASNIL
KPSLARGELQCIGATTLDEYRKYIEKDAALERRFQPIQVDQPSVDESIQILQGLRDRYEA
HHRVSITDDAIEAAVKLSDRYISDRFLPDKAIDLIDEAGSKVRLRSFTTPPNLKELEQKL
DEVRKEKDAAVQSQEFEKAASLRDTEQRLREQVEDTKKSWKEKQGQENSEVTVDDIAMVV
SSWTGVPVSKIAQTETDKLLNMENILHSRVIGQDEAVVAVAKAVRRARAGLKDPKRPIGS
FIFLGPTGVGKTELARALAESIFGDEESMIRIDMSEYMEKHSTSRLVGSPPGYVGYDEGG
QLTEKVRRKPYSVVLLDEIEKAHPDVFNILLQVLEDGRLTDSKGRTVDFRNTILIMTSNV
GASELKRNKYVGFNVQDETQNHKDMKDKVMGELKRAFRPEFINRIDEIIVFHSLEKKHLT
EIVSLMSDQLTKRLKEQDLSIELTDAAKAKVAEEGVDLEYGARPLRRAIQKHVEDRLSEE
LLRGNIHKGQHIVLDVEDGEFVVKTTAKTN
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttggaagatttacagaacgagctcaaaaagtactggcgctagcacaggaagaa
gcacttcggttaggtcataataacattggcactgagcatattttattaggactggtaaga
gaaggagagggcattgctgctaaagctcttcaagcgcttggactcggttcagaaaaaatt
cagaaagaagtagaaagtttgatcgggcgcgggcaggaaatgtctcaaacgattcattat
actcctagagctaaaaaagtcattgagctttcaatggatgaggcaagaaaactcggtcat
tcttatgtgggaacagaacatattcttcttggtctgattcgtgaaggagaaggtgttgct
gcgagagttctgaataatctcggtgtcagcttaaataaagcaagacagcaggtgctccag
cttctaggaagtaatgaaacaggatcatcagcggcaggaacaaacagcaatgcgaatacg
cctacgcttgacagcttggcaagagacttaactgctattgcgaaggaagacagccttgac
cctgtaatcggcagaagcaaggagatccagcgtgtcattgaagtgttaagccgcagaacg
aaaaacaaccctgttctcattggggaaccaggtgtaggtaaaacggctatcgcagaaggt
ttggcacagcaaattatcaataatgaagtacccgaaattttgcgtgataaacgtgtgatg
acattagacatgggaacagttgttgccggcacaaaataccgcggagaatttgaggatcgc
ctgaagaaggtcatggatgaaattcgccaggcaggaaatatcattctattcatcgatgag
ctccatacattaatcggggcaggcggagcagaaggtgctattgatgcatctaatatttta
aaaccttcacttgctcgtggcgaactccaatgtattggtgcaacgactcttgatgagtac
cgtaaatatattgaaaaagatgcagcactggaacgccgttttcagccgattcaggttgat
cagccatctgtagatgaaagtattcaaattttacaaggtctgcgtgacagatacgaagcc
caccaccgcgtttctatcactgatgatgccattgaagctgcggttaagctttctgacaga
tatatttctgaccgcttccttccggataaagcaattgacttgatcgatgaagcgggttca
aaggtgagactgcgctcatttacaacgcctcctaacttaaaagagcttgagcagaagctt
gatgaggttcgtaaagagaaggatgcggcagtgcaaagccaagagtttgaaaaagctgct
tccttgcgtgatactgaacaacgcctgcgcgagcaagtagaggatacgaagaaatcatgg
aaagagaagcaagggcaggaaaactcagaggttactgtggatgatattgcgatggttgta
tccagctggaccggtgtgcctgtatctaaaatcgcccaaactgaaactgataagcttctc
aatatggaaaacattcttcactcccgtgtcatcggccaggatgaagcagttgtagcggtt
gcaaaagccgtcagacgtgcaagagcaggattgaaagatcctaaacgcccaatcggctca
ttcattttcttaggccctacaggtgtaggtaaaacagaacttgcacgagcacttgctgaa
tccatttttggcgatgaagaatccatgatcagaattgatatgtctgaatacatggaaaaa
cattcaacttcaagacttgttggttcacctccgggttatgtgggatatgatgaaggcggt
caattgacagagaaagtcagaagaaaaccttactctgtcgtgcttcttgatgagatcgag
aaagcgcaccctgatgtcttcaatatccttctgcaagttcttgaagacggacgattgact
gattctaaaggacgcacagtcgatttccgcaataccattctgatcatgacatcaaacgtc
ggagcaagtgagctaaaacgcaataaatatgtcggctttaacgttcaggatgaaactcaa
aatcataaagacatgaaagataaagtgatgggtgaattaaaacgagcgttcagacctgag
ttcatcaaccgtattgatgaaatcattgtcttccattcacttgagaaaaaacatctcact
gagattgtgtcattaatgtctgatcaattaacgaaacgcctgaaagaacaagatctttct
atcgaattgacagatgctgcaaaagcgaaagtcgcggaagagggcgttgacctggaatac
ggtgcccgtccgttaagaagagcgatccaaaaacatgtcgaggatcgtttatctgaagaa
ctcctcagaggaaatattcataaaggacagcatattgttcttgatgtagaagatggcgaa
tttgtcgtaaaaacgactgctaaaacgaattaa

DBGET integrated database retrieval system