KEGG   Bacillus subtilis subsp. subtilis 168: BSU00940Help
Entry
BSU00940          CDS       T00010                                 

Gene name
cysS
Definition
cysteine--tRNA ligase (EC:6.1.1.16)
Orthology
K01883  
cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSU00940 (cysS)
Enzymes [BR:bsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     BSU00940 (cysS)
Amino acid related enzymes [BR:bsu01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   BSU00940 (cysS)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BSU00940 (cysS)
 Prokaryotic Type
    BSU00940 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
113450..114850
Genome map
AA seq 466 aa AA seqDB search
MTITLYNTLTRQKETFVPLEEGKVKMYVCGPTVYNYIHIGNARPAIVYDTVRNYLEYKGY
DVQYVSNFTDVDDKLIKAANELGEDVPTISERFIKAYFEDVGALGCRKADLHPRVMENMD
AIIEFVDQLVKKGYAYESEGDVYFKTRAFEGYGKLSQQSIDELRSGARIRVGEKKEDALD
FALWKAAKEGEISWDSPWGKGRPGWHIECSAMVKKYLGDQIDIHAGGQDLTFPHHENEIA
QSEALTGKTFAKYWLHNGYINIDNEKMSKSLGNFVLVHDIIKQHDPQLLRFFMLSVHYRH
PINYSEELLENTKSAFSRLKTAYSNLQHRLNSSTNLTEDDDQWLEKVEEHRKAFEEEMDD
DFNTANAISVLFDLAKHANYYLQKDHTADHVITAFIEMFDRIVSVLGFSLGEQELLDQEI
EDLIEKRNEARRNRDFALSDQIRDQLKSMNIILEDTAQGTRWKRGE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcacactttataatacattgactagacagaaggaaacattcgttcctcttgaa
gagggaaaagtgaaaatgtatgtatgcggacccacggtttacaattacattcatatcggg
aacgcgcgtccggcaatcgtttacgatacggttcgaaactatttagagtataaaggctat
gatgtgcagtatgtctctaacttcacagacgtagacgataaattaattaaagcggcaaat
gaactcggtgaggatgtacccaccatttcagagcgttttattaaagcatactttgaagac
gtaggtgcgctcggctgccgaaaagccgaccttcatccgcgagtaatggagaacatggat
gccattatcgaattcgtagatcagctcgtgaaaaagggctacgcatatgaatcagaaggt
gacgtatatttcaaaaccagagcatttgaagggtacggaaagctttctcagcaatcaatc
gatgaactaagatcaggtgcacgcatccgggtcggcgagaaaaaagaagatgctcttgat
ttcgcactgtggaaagcggcaaaagaaggagaaatctcttgggatagcccttgggggaaa
gggcgtccgggctggcacattgaatgctcagcaatggtgaaaaagtatctcggtgaccag
attgatatccatgcgggcggacaggatttaacattccctcaccatgaaaacgaaattgcg
caatctgaggcgctgacaggcaaaacgtttgcgaagtactggcttcataatggttatatc
aatattgataatgaaaaaatgtcaaaatcactaggcaactttgtgcttgtgcatgacatc
attaaacagcatgatccgcagcttttgagattctttatgctatctgttcattatcgccat
ccgattaactattcagaagagcttctggagaatacgaaaagcgcgttcagccgtttaaaa
acagcgtacagcaatcttcagcaccgtctgaacagcagtacgaatttaaccgaagatgac
gatcaatggcttgaaaaggttgaagaacaccgcaaagcattcgaagaagagatggacgat
gattttaatacggcgaatgccatttcagtcttgtttgacttagcgaaacacgccaattat
tatcttcagaaagatcatacggctgatcatgtgattacggcgtttattgagatgtttgac
cgcattgtttctgtcctcggtttttcgttgggtgagcaggaacttctcgatcaagagatt
gaagacttaatcgaaaagcgaaatgaagcgcgccggaatcgcgattttgcattgtcagac
cagatccgcgaccagctgaaaagcatgaatatcattcttgaagatacggctcaaggcact
cgctggaaacggggagaataa

DBGET integrated database retrieval system