KEGG   Bacillus subtilis subsp. subtilis 168: BSU00940Help
Entry
BSU00940          CDS       T00010                                 

Gene name
cysS
Definition
cysteine--tRNA ligase (EC:6.1.1.16)
Orthology
K01883  
cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:bsu00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
113450..114850
Genome map
AA seq 466 aa AA seqDB search
MTITLYNTLTRQKETFVPLEEGKVKMYVCGPTVYNYIHIGNARPAIVYDTVRNYLEYKGY
DVQYVSNFTDVDDKLIKAANELGEDVPTISERFIKAYFEDVGALGCRKADLHPRVMENMD
AIIEFVDQLVKKGYAYESEGDVYFKTRAFEGYGKLSQQSIDELRSGARIRVGEKKEDALD
FALWKAAKEGEISWDSPWGKGRPGWHIECSAMVKKYLGDQIDIHAGGQDLTFPHHENEIA
QSEALTGKTFAKYWLHNGYINIDNEKMSKSLGNFVLVHDIIKQHDPQLLRFFMLSVHYRH
PINYSEELLENTKSAFSRLKTAYSNLQHRLNSSTNLTEDDDQWLEKVEEHRKAFEEEMDD
DFNTANAISVLFDLAKHANYYLQKDHTADHVITAFIEMFDRIVSVLGFSLGEQELLDQEI
EDLIEKRNEARRNRDFALSDQIRDQLKSMNIILEDTAQGTRWKRGE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcacactttataatacattgactagacagaaggaaacattcgttcctcttgaa
gagggaaaagtgaaaatgtatgtatgcggacccacggtttacaattacattcatatcggg
aacgcgcgtccggcaatcgtttacgatacggttcgaaactatttagagtataaaggctat
gatgtgcagtatgtctctaacttcacagacgtagacgataaattaattaaagcggcaaat
gaactcggtgaggatgtacccaccatttcagagcgttttattaaagcatactttgaagac
gtaggtgcgctcggctgccgaaaagccgaccttcatccgcgagtaatggagaacatggat
gccattatcgaattcgtagatcagctcgtgaaaaagggctacgcatatgaatcagaaggt
gacgtatatttcaaaaccagagcatttgaagggtacggaaagctttctcagcaatcaatc
gatgaactaagatcaggtgcacgcatccgggtcggcgagaaaaaagaagatgctcttgat
ttcgcactgtggaaagcggcaaaagaaggagaaatctcttgggatagcccttgggggaaa
gggcgtccgggctggcacattgaatgctcagcaatggtgaaaaagtatctcggtgaccag
attgatatccatgcgggcggacaggatttaacattccctcaccatgaaaacgaaattgcg
caatctgaggcgctgacaggcaaaacgtttgcgaagtactggcttcataatggttatatc
aatattgataatgaaaaaatgtcaaaatcactaggcaactttgtgcttgtgcatgacatc
attaaacagcatgatccgcagcttttgagattctttatgctatctgttcattatcgccat
ccgattaactattcagaagagcttctggagaatacgaaaagcgcgttcagccgtttaaaa
acagcgtacagcaatcttcagcaccgtctgaacagcagtacgaatttaaccgaagatgac
gatcaatggcttgaaaaggttgaagaacaccgcaaagcattcgaagaagagatggacgat
gattttaatacggcgaatgccatttcagtcttgtttgacttagcgaaacacgccaattat
tatcttcagaaagatcatacggctgatcatgtgattacggcgtttattgagatgtttgac
cgcattgtttctgtcctcggtttttcgttgggtgagcaggaacttctcgatcaagagatt
gaagacttaatcgaaaagcgaaatgaagcgcgccggaatcgcgattttgcattgtcagac
cagatccgcgaccagctgaaaagcatgaatatcattcttgaagatacggctcaaggcact
cgctggaaacggggagaataa

DBGET integrated database retrieval system