KEGG   Bacillus subtilis subsp. subtilis 168: BSU01190Help
Entry
BSU01190          CDS       T00010                                 

Gene name
rplB
Definition
(RefSeq) 50S ribosomal protein L2
  KO
K02886  
large subunit ribosomal protein L2
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    BSU01190 (rplB)
Ribosome [BR:bsu03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01190 (rplB)
  Bacteria
    BSU01190 (rplB)
  Archaea
    BSU01190 (rplB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
137311..138144
Genome map
AA seq 277 aa AA seqDB search
MAIKKYKPTSNGRRGMTTSDFAEITTDKPEKSLLAPLHKKGGRNNQGKLTVRHQGGGHKR
QYRVIDFKRDKDGIPGRVATVEYDPNRSANIALINYADGEKRYILAPKGIQVGTEIMSGP
EADIKVGNALPLINIPVGTVVHNIELKPGKGGQLVRSAGTSAQVLGKEGKYVLVRLNSGE
VRMILSACRASIGQVGNEQHELINIGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGRAP
IGRKSPMSPWGKPTLGFKTRKKKNKSDKFIVRRRKNK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggcgattaaaaagtataaaccgacctctaatggacgtcgtggcatgacaacttcagat
tttgctgaaatcacgactgacaagccggaaaaatccttgcttgctccccttcacaaaaaa
ggcggacgtaacaaccaaggtaaattgactgtacgtcaccaaggtggcggacataaacgc
caataccgtgttatcgacttcaaacgcgataaagatggtatacctggacgcgttgctaca
gttgaatacgatccaaaccgttcagctaacatcgctctaatcaactatgcagacggagaa
aaacgttacattcttgctcctaaaggaattcaagtaggtactgaaatcatgtcaggtcct
gaagctgacattaaagtaggtaatgcacttccacttatcaacatccctgttggtacagtt
gtgcataacattgaattaaaacctggtaaaggcggacagcttgtacgttcagctggtaca
tctgctcaggttcttggtaaagaaggtaaatacgttcttgtacgtcttaactctggtgaa
gttcgcatgatcctttctgcttgccgtgcttctatcggtcaagtaggtaacgaacagcac
gaacttatcaacattggtaaagctggacgttctcgctggaaaggcatccgtcctacagtt
cgtggttctgtaatgaaccctaacgatcacccacacggtggtggtgaaggacgtgcgcca
atcggacgtaaatcaccaatgtctccatggggcaaaccaactcttggattcaagactcgt
aagaaaaagaacaaatccgataaatttatcgtacgtcgtcgtaaaaataaataa

DBGET integrated database retrieval system