KEGG   Bacillus subtilis subsp. subtilis 168: BSU01320Help
Entry
BSU01320          CDS       T00010                                 

Gene name
rplR
Definition
(RefSeq) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Module
bsu_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    BSU01320 (rplR)
Ribosome [BR:bsu03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01320 (rplR)
  Bacteria
    BSU01320 (rplR)
  Archaea
    BSU01320 (rplR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L18p
Motif
Other DBs
NCBI-GeneID: 936785
NCBI-ProteinID: NP_388013
Pasteur: BG11409
BSORF: BG11409
UniProt: P46899
Structure
PDB: 

Jmol
Position
142974..143336
Genome map
AA seq 120 aa AA seqDB search
MITKTSKNAARLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQIIDDVNGVTLASASTLD
KDLNVESTGDTSAATKVGELVAKRAAEKGISDVVFDRGGYLYHGRVKALADAAREAGLKF
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgattacgaaaactagcaaaaatgctgctcgtcttaaaagacacgctcgtgttcgcgct
aaactttccggtactgctgaaagaccgcgcctgaacgttttccgttctaacaagcacatt
tacgctcaaatcatcgatgatgtaaatggtgtaacacttgctagtgcatctactctcgat
aaagacttgaacgttgaaagcactggagatacttctgctgctactaaagttggagaatta
gttgcaaaacgcgctgctgaaaaaggcatttctgacgtagtatttgaccgtggcggatac
ttataccatggacgtgtaaaagctttggctgatgccgctcgtgaagctggacttaaattt
taa

DBGET integrated database retrieval system