KEGG   Bacillus subtilis subsp. subtilis 168: BSU01360Help
Entry
BSU01360          CDS       T00010                                 

Gene name
secY
Definition
(RefSeq) protein translocase subunit SecY
  KO
K03076  
preprotein translocase subunit SecY
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    BSU01360 (secY)
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    BSU01360 (secY)
Secretion system [BR:bsu02044]
 Sec (secretion) system
  Bacterial Sec-SRP core components [MD:M00335]
   BSU01360 (secY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
144527..145822
Genome map
AA seq 431 aa AA seqDB search
MFKTISNFMRVSDIRNKIIFTLLMLIVFRIGAFIPVPYVNAEALQAQSQMGVFDLLNTFG
GGALYQFSIFAMGITPYITASIIIQLLQMDVVPKFTEWSKQGEVGRRKLAQFTRYFTIVL
GFIQALGMSYGFNNLANGMLIEKSGVSTYLIIALVLTGGTAFLMWLGEQITSHGVGNGIS
IIIFAGIVSSIPKTIGQIYETQFVGSNDQLFIHIVKVALLVIAILAVIVGVIFIQQAVRK
IAIQYAKGTGRSPAGGGQSTHLPLKVNPAGVIPVIFAVAFLITPRTIASFFGTNDVTKWI
QNNFDNTHPVGMAIYVALIIAFTYFYAFVQVNPEQMADNLKKQGGYIPGVRPGKMTQDRI
TSILYRLTFVGSIFLAVISILPIFFIQFAGLPQSAQIGGTSLLIVVGVALETMKQLESQL
VKRNYRGFMKN
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaaaacaatctccaactttatgcgtgtgagtgatatcaggaataaaatcatattc
actttactcatgcttatcgtctttcgcataggtgcgtttattcctgtgccttacgttaac
gctgaagcgttacaggcacagtctcaaatgggtgtttttgatctccttaatacatttggc
ggcggtgcgctttaccaattttccattttcgcaatgggaattactccttatatcacggct
tcgatcatcattcagctgcttcagatggatgtggtaccgaagtttaccgagtggtctaag
caaggtgaagttggccgccgtaaattagctcagttcacaaggtactttacgattgtgctt
ggtttcatccaagcgttaggtatgtcatatggattcaacaatctggcaaacggtatgctg
atcgaaaaatccggtgtatcgacatatcttatcattgctttagtgctcactggcggaact
gcctttttaatgtggcttggggaacaaattacttctcatggagtaggcaacggaatatcg
atcattatcttcgcggggattgtgtctagtattccaaaaacaattgggcaaatatatgag
actcaatttgtcggcagcaacgatcagttgtttattcatattgtgaaagtcgcacttctt
gtgattgcgattttagcagttattgttggagttattttcattcagcaagccgtacggaaa
attgcgattcaatatgctaaaggcacaggtcgttcacctgctggcggaggtcagtctaca
caccttccattgaaagtgaatcctgcaggggttattccggtaatctttgcggttgcgttt
ttgataacgccgcggacgatcgcgtcattctttggaacaaacgatgtgacaaagtggatt
caaaacaactttgataatacgcatccggtgggtatggcgatatatgttgcgttgattatt
gcctttacgtacttttatgcttttgtacaggtaaaccctgaacaaatggctgataacctt
aaaaaacagggtggctatatcccgggggttcgtccagggaaaatgactcaagatagaatt
acgagcattttgtatcgacttacgtttgtgggttctatattcttagccgtgatttccatt
cttcctatctttttcattcaattcgctggattgcctcaaagtgcacaaattggcggaaca
tctttgttaattgttgtcggggtagccttggagacaatgaaacaactagaaagccagttg
gtgaaacgaaactaccgtggatttatgaaaaactag

DBGET integrated database retrieval system