KEGG   Bacillus subtilis subsp. subtilis 168: BSU01630Help
Entry
BSU01630          CDS       T00010                                 

Gene name
feuA
Definition
(RefSeq) iron-uptake system-binding protein
  KO
K02016  
iron complex transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
ABC transporters
Module
Iron complex transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BSU01630 (feuA)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    BSU01630 (feuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(182370..183323)
Genome map
AA seq 317 aa AA seqDB search
MKKISLTLLILLLALTAAACGSKNESTASKASGTASEKKKIEYLDKTYEVTVPTDKIAIT
GSVESMEDAKLLDVHPQGAISFSGKFPDMFKDITDKAEPTGEKMEPNIEKILEMKPDVIL
ASTKFPEKTLQKISTAGTTIPVSHISSNWKENMMLLAQLTGKEKKAKKIIADYEQDLKEI
KTKINDKAKDSKALVIRIRQGNIYIYPEQVYFNSTLYGDLGLKAPNEVKAAKAQELSSLE
KLSEMNPDHIFVQFSDDENADKPDALKDLEKNPIWKSLKAVKEDHVYVNSVDPLAQGGTA
WSKVRFLKAAAEKLTQN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatatctcttaccttattaatcttacttctcgcgctgacggcggcagcttgc
ggcagcaaaaatgaatcaactgccagcaaggcaagcggcacagcatctgagaagaagaaa
attgaataccttgataaaacatatgaagtaactgtaccgacagacaaaattgccattacg
ggaagcgttgaatcaatggaagacgcgaaattgcttgacgttcatccgcaaggcgcaatt
tcattctccggcaaattccctgatatgttcaaagacatcactgataaagccgaaccaacc
ggagaaaaaatggagccaaatattgaaaagattcttgaaatgaagccagatgttatcctt
gcttcaacaaagtttccggaaaaaacgctgcaaaaaatcagcacagcaggcacgacgatc
ccagtttctcatatctcttcaaactggaaggaaaacatgatgcttcttgcccagctgact
ggaaaagagaaaaaagcaaagaaaattattgcagactatgaacaggatctaaaagaaata
aaaacaaaaatcaacgataaagcgaaagattcaaaagcgcttgtcatcagaatcagacaa
ggcaacatttacatttaccctgaacaggtgtatttcaactccacactatacggtgattta
ggccttaaggcgccgaacgaagtaaaggctgcaaaagcgcaagagctgagttcattagaa
aaattaagtgaaatgaacccggaccatattttcgtccaattttctgatgatgaaaatgca
gacaaacctgatgccttaaaagatttagagaaaaatccaatctggaaaagccttaaagca
gtcaaagaagaccatgtgtatgtcaactcagtggaccctctcgcacaaggcggcacagct
tggagcaaagtccgtttcctgaaagcggctgctgaaaaattgacacaaaactaa

DBGET integrated database retrieval system