KEGG   Bacillus subtilis subsp. subtilis 168: BSU01950Help
Entry
BSU01950          CDS       T00010                                 

Gene name
skfE
Definition
(RefSeq) SkfA peptide export ATP-binding protein SkfE
  KO
K01990  
ABC-2 type transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
ABC-2 type transport system
Brite
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    BSU01950 (skfE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
216913..217632
Genome map
AA seq 239 aa AA seqDB search
MQLMQVQNLSKCYRNGDGVEHLSFSIQRGEIVALLGPNGAGKTTTIRCLTGLYKPDKGDI
LIEGSPPGDINVQKKVALIPDQPYLYPALTAAEHIQFRARGYHPGKKDVKERVYHALKEV
HLEEKANQLCGQLSRGQKQRVVLAGAIVQDALLYILDEPTVGLDIPSKQWLSNWLKTKTD
QGCSAFVSTHSLEFVIETADRVILIRDGKLMQDLYVPQFEEQAEWRKEVIRLLGEWSDE
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaattgatgcaagtacaaaatttaagcaaatgctatcgaaatggtgatggggttgaa
catttgtctttctcaattcaacgaggagaaatcgtggcgctattggggccaaatggagct
ggaaaaacaacgacaattcgatgtttgacaggtctctataagccggataaaggagatatc
ctcattgagggttctcctccaggagatataaatgttcaaaaaaaagtcgcgcttattcct
gatcagccatatttgtatcccgctttaactgctgctgaacatattcagtttagggcaaga
ggatatcatccaggtaaaaaagatgtaaaagaaagggtttatcatgcattgaaggaagtg
cacttggaggagaaagcaaaccaattgtgtggtcagctgtcaagaggccaaaagcagcgg
gttgtcctggcgggggcgattgttcaagacgctttgctgtatatattagacgaaccgact
gtgggccttgatatcccatcaaaacagtggctctctaactggttaaaaactaaaaccgat
caagggtgttcagcatttgtatcaactcatagtctagagtttgttatagagacagcagac
agggtgatattaattagagacggcaaactcatgcaggatttgtatgttcctcaattcgaa
gaacaagcggaatggagaaaagaagtgattcgtcttctaggggaatggtcagatgaataa

DBGET integrated database retrieval system