KEGG   Bacillus subtilis subsp. subtilis 168: BSU02530Help
Entry
BSU02530          CDS       T00010                                 

Gene name
rtpA
Definition
(RefSeq) tryptophan RNA-binding attenuator protein inhibitory protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Anti-TRAP DnaJ_CXXCXGXG HypA Lar_restr_allev DUF1356
Motif
Other DBs
NCBI-GeneID: 938403
NCBI-ProteinID: NP_388135
Pasteur: BG12776
BSORF: BG12776
UniProt: O31466
Structure
PDB: 

Jmol
Position
277160..277321
Genome map
AA seq 53 aa AA seqDB search
MVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK
NT seq 162 nt NT seq  +upstreamnt  +downstreamnt
atggtcattgcaactgatgatcttgaggtcgcatgtcctaaatgtgaaagagcgggagaa
atcgaaggaacaccttgcccggcctgcagcggaaaaggtgttattctgactgctcaagga
tatacgcttctcgattttatccaaaagcatttgaataagtaa

DBGET integrated database retrieval system