KEGG   Bacillus subtilis subsp. subtilis 168: BSU02620Help
Entry
BSU02620          CDS       T00010                                 

Gene name
phoD
Definition
alkaline phosphatase D (EC:3.1.4.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSU02620 (phoD)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BSU02620 (phoD)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BSU02620 (phoD)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BSU02620 (phoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
284011..285762
Genome map
AA seq 583 aa AA seqDB search
MAYDSRFDEWVQKLKEESFQNNTFDRRKFIQGAGKIAGLSLGLTIAQSVGAFEVNAAPNF
SSYPFTLGVASGDPLSDSVVLWTRLAPDPLNGGGMPKQAVPVKWEVAKDEHFRKIVRKGT
EMAKPSLAHSVHVEADGLEPNKVYYYRFKTGHELSPVGKTKTLPAPGANVPQMTFAFASC
QQYEHGYYTAYKHMAKEKLDLVFHLGDYIYEYGPNEYVSKTGNVRTHNSAEIITLQDYRN
RHAQYRSDANLKAAHAAFPWVVTWDDHEVENNYANKIPEKGQSVEAFVLRRAAAYQAYYE
HMPLRISSLPNGPDMQLYRHFTYGNLASFNVLDTRQYRDDQANNDGNKPPSDESRNPNRT
LLGKEQEQWLFNNLGSSTAHWNVLAQQIFFAKWNFGTSASPIYSMDSWDGYPAQRERVIN
FIKSKNLNNVVVLTGDVHASWASNLHVDFEKTSSKIFGAEFVGTSITSGGNGADKRADTD
QILKENPHIQFFNDYRGYVRCTVTPHQWKADYRVMPFVTEPGAAISTRASFVYQKDQTGL
RKVSSTTIQGGVKQSDEVEEDRFFSHNKAHEKQMIKKRAKITN
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggcatacgacagtcgttttgatgaatgggtacagaaactgaaagaggaaagctttcaa
aacaatacgtttgaccgccgcaaatttattcaaggagcggggaagattgcaggactttct
cttggattaacgattgcccagtcggttggggcctttgaagtaaatgctgcgcctaacttc
tcaagctatccgtttacattaggggtagcgtcaggtgatccgctttctgacagtgtcgtg
ctttggacacgtctggcaccagatccgctgaatggcgggggaatgccgaagcaagcagtg
cctgtcaaatgggaggtcgcaaaggatgagcatttccgcaaaatcgtaagaaaaggcact
gaaatggctaaaccaagtcttgcccattccgttcatgtggaagcggacgggcttgagcca
aacaaagtgtactattaccgtttcaaaaccggccatgaactaagccctgtcggaaaaaca
aaaacactgcctgcccctggcgccaatgtgccgcaaatgacctttgcatttgcttcctgc
cagcaatatgagcacggatattatacggcctacaagcatatggcaaaggaaaagcttgat
cttgtcttccatctcggtgattacatatatgaatacggcccaaatgaatatgtatcaaaa
acaggcaatgtccgcacgcacaacagcgcggaaatcattacgctgcaagactatcggaac
cgtcacgctcaataccgttctgacgccaatcttaaagctgcacatgcggcattcccttgg
gttgtaacttgggatgaccatgaagttgaaaacaactatgccaataaaatacctgaaaaa
ggacagtcggttgaagcattcgtgctccgccgcgcggcagcataccaggcatactatgaa
catatgccgctccgcatttcctctttgccgaatggcccagatatgcagctgtaccggcac
tttacgtacggaaacctggcgtccttcaatgtgcttgatacccgccagtacagggacgac
caagccaataacgacggcaataagccgccttctgatgaatcgcgcaatccgaatcggact
ctgcttggaaaagaacaggagcagtggctcttcaacaatttgggcagctcgacagcccac
tggaatgtgctggcgcagcagattttctttgccaagtggaatttcgggacaagcgcaagc
ccgatctacagcatggattcgtgggacggctacccggctcagcgcgaacgggttatcaat
ttcattaaaagcaaaaatctgaataatgttgtcgtactgacaggtgatgtacacgcaagc
tgggcatcgaatttgcatgtcgatttcgagaagacaagttcaaaaatattcggagccgaa
tttgttggaacctcgatcacttccggagggaacggagcggataagcgagcggatacggac
caaattttaaaagaaaatccgcacatccagttctttaacgactatcgcggatatgtccgc
tgtacagtgacgcctcaccagtggaaagccgattatcgggtgatgccatttgtgaccgag
ccgggcgcagccatttccacgcgggcttcattcgtttaccagaaagaccaaaccgggttg
agaaaggtatcatccacaacaatccaaggcggggtgaagcaatccgatgaggtcgaagag
gatcgtttcttttcgcacaacaaagcccacgaaaaacaaatgattaagaagcgtgcaaaa
atcacgaattaa

DBGET integrated database retrieval system