KEGG   Bacillus subtilis subsp. subtilis 168: BSU03280Help
Entry
BSU03280          CDS       T00010                                 

Gene name
nasF
Definition
uroporphyrinogen-iii C-methyltransferase (EC:2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSU03280 (nasF)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     BSU03280 (nasF)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BSU03280 (nasF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(353900..355351)
Genome map
AA seq 483 aa AA seqDB search
MIMKNGIVYFVGAGPGDPGLLTIKGKQALKEADVILYDRLANPKLLEFASPDCQFIYCGK
LPNRHFMKQKEINALLVEKALNGLTVVRLKGGDPSVFGRVGEEADALHEHGIRYEMVPGI
TSGIAAPLYAGIPVTHRDFASSFAMITAHDKSLKGTPNLDWEGLARSVQTLVFYMGVKNL
SYICQQLISYGKSPSVPVIVIQWGTWGRQRSVKGTLENIQQKVQEHQITNPAIIVIGDIV
NFQTHSWFESKPLIGRHLMVVTHGEDEDPLADKLRDSGADLIEWPKWRTENMPVNEEILR
KIGTFEDVFFTSRRAVCEFFRALASQKIDIRQLTAKLSAASEQAKTELEKRGFLVTAIQP
DSEKRLVVGSRHAVENMQKHESCSFYITHENVIDDRFTHMIQRTISESPLHMVICPNKLS
VQQLINGGEQIGILPEPSASRPPIVCIGDDSAAGIYGFTAVQEQDELLAFIHNQHAEKKL
LHT
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgaagaacggaatcgtatatttcgtgggagccggacccggcgacccaggcctg
ctcaccatcaaaggaaaacaggcgctcaaggaagcagatgtgattttatatgaccggctc
gccaacccgaagctgctcgaatttgcatcaccggactgccagtttatttattgcggaaaa
ctgccaaaccgccattttatgaaacaaaaagaaattaacgccctgctggttgaaaaagca
ttaaatgggttaaccgtcgttcgcttgaagggcggagatccgagcgtattcggcagagtc
ggcgaggaagcagatgctcttcatgagcacggcattcgctatgaaatggtgccgggaatc
acctctggaattgcagcgccgctatatgcgggcatccccgtcacgcatcgggattttgca
tcgtcttttgccatgattacagcgcatgataaatcattaaaaggcacgccgaaccttgac
tgggaagggctggcccgaagcgttcaaacccttgttttttacatgggtgtcaagaacttg
tcttatatttgccagcagcttatttcatacgggaaatcgccttctgtccctgtcattgtc
atccaatggggaacgtggggccgccagcggagtgtgaaaggaacacttgagaacattcag
caaaaagtgcaggaacaccagattacaaaccctgcgattatcgtcatcggagacatcgtc
aactttcaaacacacagctggtttgaaagcaaaccgctcatcggacggcatttgatggtt
gtgactcatggcgaagatgaagacccgcttgcagacaagctgcgcgattccggcgccgat
ctcatcgagtggccgaaatggcggaccgaaaacatgcctgtcaatgaagaaattcttcga
aagattggcacctttgaagacgtttttttcacatcgcgccgggcggtttgtgaatttttc
agagcactggcttctcagaaaatcgacatccgccagctgacagccaaactgagtgcagca
tctgagcaagcaaagacagagcttgagaaacggggctttcttgtcaccgccattcagcct
gattcagagaaacgtcttgttgtcgggagccgccatgcagtggaaaacatgcaaaagcat
gaatcctgttcgttttatatcactcatgaaaacgtcatagatgaccggttcacccacatg
attcagcgtaccatcagtgaatccccgctgcacatggtcatttgcccaaacaagctgtcc
gttcagcaattgatcaatggtggcgaacaaattggcattttgccggaaccgtcagcaagc
cgccctcctatcgtctgcataggcgatgactcagctgccggcatttatggattcacagcc
gtacaagaacaggatgaattgctagctttcatccacaatcaacatgcagagaaaaaactc
cttcacacctga

DBGET integrated database retrieval system