KEGG   Bacillus subtilis subsp. subtilis 168: BSU03290Help
Entry
BSU03290          CDS       T00010                                 

Gene name
nasE
Definition
(RefSeq) assimilatory nitrite reductase [NAD(P)H] small subunit (EC:1.7.1.4)
  KO
K00363  
nitrite reductase (NADH) small subunit [EC:1.7.1.15]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BSU03290 (nasE)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     BSU03290 (nasE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(355412..355732)
Genome map
AA seq 106 aa AA seqDB search
MVNKDVTKVCIGKIEELPEQLGKTVYIEDKELAVFKLSDGSIRAIENRCPHKGGVLAEGI
VSGQYVFCPMHDWKISLEDGIVQEPDHGCVKTYETLIEGEHVYLVY
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacaaagacgtaacaaaagtatgtatcggaaaaattgaagaattgcctgaacaa
ttaggcaaaacagtgtatattgaagataaggagctcgcggttttcaagctttcagacgga
agcatccgcgccattgaaaaccgctgtccgcataagggcggcgtcctggcagaaggcatc
gtcagcggtcaatatgttttctgcccgatgcacgactggaaaatttccttagaagacgga
atcgtccaagaacctgaccacggatgcgtcaaaacatatgaaacgctgatcgaaggagaa
catgtttatctcgtatattga

DBGET integrated database retrieval system