KEGG   Bacillus subtilis subsp. subtilis 168: BSU03360Help
Entry
BSU03360          CDS       T00010                                 

Gene name
yciC
Definition
(RefSeq) metal chaperone YciC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
366063..367256
Genome map
AA seq 397 aa AA seqDB search
MKKIPVTVLSGYLGAGKTTLLNSILQNREGLKIAVIVNDMSEVNIDAGLVKQEGGLSRTD
EKLVEMSNGCICCTLREDLLIEVEKLAKDGRFDYIVIESTGISEPIPVAQTFSYIDEEMG
IDLTKFCQLDTMVTVVDANRFWHDYQSGESLLDRKEALGEKDEREIADLLIDQIEFCDVL
ILNKCDLVSEQELEQLENVLRKLQPRARFIRSVKGNVKPQEILHTGLFNFEEASGSAGWI
QELTAGHAEHTPETEEYGISSFVYKRRLPFHSTRFYRWLDQMPKNVVRAKGIVWCASHNN
LALLMSQAGPSVTIEPVSYWVAALPKLEQEQVKQQEPEILEEWDPEFGDRLTQLVFIGTD
LDEETITKELDQCLLTEYEFDSDWSLFEDPFKWKLNQ
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattccggttaccgtactgagcggttatctcggtgcgggaaaaacaacattg
ctgaacagcattttgcaaaatcgcgaaggcttgaaaatagcggttatcgtaaacgatatg
agcgaggtgaacattgacgcgggcttggttaagcaggaaggtggcctttccagaacagat
gaaaagcttgtggaaatgtcaaatggctgcatttgctgcacgcttcgcgaagacttatta
attgaagttgagaagctggcaaaagacggacggtttgattatatcgtcatcgaatcgaca
ggaatcagcgaaccgatcccggtggcccagactttctcttatatcgatgaagagatggga
atcgatcttacaaaattctgtcagctggatacgatggtgacggttgttgatgccaaccgt
ttttggcatgattatcagtcaggcgaaagccttctggaccgcaaagaagcattgggggaa
aaggatgaaagagaaatcgccgacctcttgatcgatcaaattgagttttgcgatgtactg
atcttaaataaatgtgatttggtcagcgagcaagagctcgaacagcttgaaaacgttctt
cgtaaactgcagccaagagccaggttcattcgttccgtcaaaggaaatgtaaaaccgcag
gagattttgcatacagggttatttaacttcgaggaagcgagcggatcggccggctggatt
caagagctgacggcaggccatgcggaacacaccccggaaacagaagaatacggtatctct
tcatttgtatataagagacgtttgccgtttcattctacacgattttaccgttggttggat
caaatgccaaagaacgtggtacgtgccaaaggaatcgtctggtgcgcatctcataacaac
ctcgctttgctgatgtcgcaagcaggtccgtcggttacgattgagcctgtatcttattgg
gtggcggcgttgccgaagcttgagcaggagcaagtcaaacagcaggagccggaaatcctg
gaggagtgggacccggagttcggcgaccgcctaacgcagctagtttttatcggaactgac
ctggatgaagaaacgatcacgaaagagcttgatcaatgcctgttgactgagtatgaattt
gattccgactggtcgctgtttgaggacccgtttaaatggaagctgaatcaatag

DBGET integrated database retrieval system